DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or2a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:414 Identity:84/414 - (20%)
Similarity:166/414 - (40%) Gaps:78/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EESKMN---KLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIG---FVT--VG 80
            |:.|:|   .:.:|...|.....:...|:...:||..:...|..:..:..||.:.   |.|  .|
  Fly     5 EDFKLNTHSAVYYHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAG 69

  Fly    81 MSKMFFIRWKKTAITELINELK--EIYPNGLIREERYNLPMYL----------GTCSRISLI--- 130
            :.:...|     .||:::..||  .:|   ::|::.:.:...|          |....||.:   
  Fly    70 LCENLTI-----TITDIVANLKFANVY---MVRKQLHEIRSLLRLMDARARLVGDPEEISALRKE 126

  Fly   131 -------YSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPW---KWQDNWSYYPL 185
                   :....|:.::...|.||            |||.:....|:|..|   .|..:...|.|
  Fly   127 VNIAQGTFRTFASIFVFGTTLSCV------------RVVVRPDRELLYPAWFGVDWMHSTRNYVL 179

  Fly   186 L-FSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFL-------------SNSMERHELSGDWKK 236
            : ..|.|.....|....::|....|....|..|...|             ||..:.:|.   |::
  Fly   180 INIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEA---WRE 241

  Fly   237 D-SRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPD-----IVVK 295
            : .:.|::.:|...|:.||.:.:..:..:|.:..|:.|:.|.|.|.... :.|..|     :::.
  Fly   242 EVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHF-LYVADDHDHTAMIIS 305

  Fly   296 LFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKAT 360
            :..|...:: :|::||::|..:...|.....|.|:..|.:...::||.|:..:||:|:.:.:.|.
  Fly   306 IVFFSAVTL-EVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAG 369

  Fly   361 IFLDITRSTMTDLLQISYKFFALL 384
            .::.::..|...:::.:|..|.||
  Fly   370 NYIALSLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 71/363 (20%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 67/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.