DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or1a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_525029.2 Gene:Or1a / 30978 FlyBaseID:FBgn0029521 Length:392 Species:Drosophila melanogaster


Alignment Length:170 Identity:35/170 - (20%)
Similarity:64/170 - (37%) Gaps:54/170 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 HERILRLSDAVNDIFGIPLLLNFMVSSF------------VIC------------FVGFQMTVGV 288
            |.|:|::....|        .:||..:|            |||            |:||      
  Fly   246 HARLLKIVQHFN--------YSFMEIAFVEVVIICGLYCSVICQYIMPHTNQNFAFLGF------ 296

  Fly   289 PPDIVVKLFLFLVSSMSQVYLICHYG--QLVADASYGFSVATYNQ-KWYKADVRYKRALVIIIAR 350
                    |..:|::...:||   :|  |:..:|. .||...|.. .|.....::::..:..|.|
  Fly   297 --------FSLVVTTQLCIYL---FGAEQVRLEAE-RFSRLLYEVIPWQNLPPKHRKLFLFPIER 349

  Fly   351 SQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTMYTQ 390
            :|:.|.|.| .|.::.|..:..:.:.:..|..|:..:|.:
  Fly   350 AQRETVLGA-YFFELGRPLLVWIFRTAGSFTTLMNALYAK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 32/156 (21%)
Or1aNP_525029.2 7tm_6 79..376 CDD:251636 32/156 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.