DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR54

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_320702.1 Gene:GPROR54 / 1280835 VectorBaseID:AGAP011813 Length:366 Species:Anopheles gambiae


Alignment Length:389 Identity:81/389 - (20%)
Similarity:150/389 - (38%) Gaps:110/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VGIRPYTNGEESKMNKLIFHIV-------FWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALS 72
            :||..:|.|..|  ..|:..:|       ||.|:.:|:        ..|...:|  |:.:...|.
Mosquito    40 LGIDIFTPGYSS--TNLLLRMVLLNTFTFFWINLYSLT--------TTYGNLVD--FMYSFETLL 92

  Fly    73 YIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSV 137
            |:|...:   ||:.....||.|.::...:.:.:.:  ...:|....:.:.|.:..:|: |.|::|
Mosquito    93 YVGIACI---KMYVFIKNKTLILQMHQYMIDFFDH--FHGDREQDELLVRTLNNTTLL-SSLFAV 151

  Fly   138 -------------LIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQ 189
                         |:|:.    .:||              .||:..:||....|           
Mosquito   152 CSSSAPGLLFVGSLLWSI----AVEY--------------VLPFGFFIPTVGMD----------- 187

  Fly   190 NFAGYTSAAG--QISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSRFLVDIVRYHERIL 252
            ...|||...|  .:.|.:::..:.:.....|.|..|:.              ..||::||.:.:.
Mosquito   188 TLQGYTLNYGFQMLETTLMVIGIISSESAFFMFQQNAC--------------LQVDMLRYSKSMC 238

  Fly   253 RLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGV-----PPDIVVKLFLFLVSSMSQVYLICH 312
            .|.:           |:|.:   |...:.||:...|     .||.....|||::.:: |::..|.
Mosquito   239 SLFE-----------LHFFI---VFGCIFFQLVSNVVVIVSVPDWYPGYFLFIMLTV-QLFFSCA 288

  Fly   313 YGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQ---KVTFLKATI----FLDITRST 369
            .|:.....|...:||.||..||..:||.::|:.:::..||   ::::...|:    |.:|.|.|
Mosquito   289 LGETFNIKSDELTVAIYNVPWYNMEVRDQKAMRLLLMASQNPGRLSYGFGTVNMRAFFEIFRKT 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 68/333 (20%)
GPROR54XP_320702.1 7tm_6 80..353 CDD:251636 69/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.