DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR74

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_318795.1 Gene:GPROR74 / 1279124 VectorBaseID:AGAP009720 Length:386 Species:Anopheles gambiae


Alignment Length:419 Identity:83/419 - (19%)
Similarity:155/419 - (36%) Gaps:83/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLMKYASFFYTAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEA 67
            ||||....:....|:..:|  ...|.....:::.|...|...|      :::....::|:. :..
Mosquito     9 KLMKSLIVYSKVAGVEIWT--APGKFTPASYYVSFHITVYFAS------TVWTLRKYIDDP-IHT 64

  Fly    68 VTALSYIGFVTVGMSKMFFIRWKKTA-----ITELINELKEIYPNGLIREERYNLPMYLGTCSRI 127
            :..|..:| ..|.:...||:...|..     ..:|..|:.:.|.||  .||..::..:.|.    
Mosquito    65 MKVLITLG-TAVQLYIKFFVGHSKAREINLFTAKLEQEVLQRYQNG--SEEETDVLRHTGR---- 122

  Fly   128 SLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMY-IPW-KWQDNWSY-YPLLFSQ 189
              |..|:|.::..:: :|..:.:.:|..:... ..||.:|..:| :|: .|..:..| ..:.|..
Mosquito   123 --ILWLVYRMISASY-IFLAVAFGMYPAFYCF-ATGKVMPLFLYELPFCDWSSSLGYAVTICFQI 183

  Fly   190 N------------------FAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSM-------ER-H 228
            |                  :|.|..|...||            ::|...|.|.:       || .
Mosquito   184 NLLAIGVLGAILSDFVFFMYAMYAMARADIS------------IVHLGELKNMLNDPTKNEERTA 236

  Fly   229 ELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPD-- 291
            |:...|       :..:..|::.......:..|||:..|.....::|.||..   |.:.:..|  
Mosquito   237 EIRRKW-------IQCMHDHQQSTSFFTMIEHIFGLICLTQVATATFSICDA---MLLVILTDWY 291

  Fly   292 -IVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVT 355
             ....|::..| .:|..:||.|..:|..||.|.   ...:...||..|:.::....:::|.|...
Mosquito   292 PTYSYLYVMFV-QLSGFFLIGHLVELKNDALYN---KVISMPRYKLPVKEQKDFRFLMSRQQNPM 352

  Fly   356 FLKATIFLDITRSTMTDLLQISYKFFALL 384
            .|.|..|..:.......:|:..|:||.::
Mosquito   353 MLTAYGFHPMNFEVYMSVLKRLYQFFVMI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 69/350 (20%)
GPROR74XP_318795.1 7tm_6 65..372 CDD:251636 68/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.