DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR23

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_317710.1 Gene:GPROR23 / 1278165 VectorBaseID:AGAP007797 Length:380 Species:Anopheles gambiae


Alignment Length:246 Identity:50/246 - (20%)
Similarity:94/246 - (38%) Gaps:49/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GKQLPYLMY-IPWKWQDNWSYYPLLFSQNFAG--------------YTSAAGQISTDVLLCAVAT 212
            |..||::.| .|..:..||.|.   |.|...|              ..:|.||:  ||:: ....
Mosquito   158 GFYLPFVDYRTPVGFAINWVYQ---FVQVLEGCIGLMACDSCLLVLIMNATGQM--DVII-VYLK 216

  Fly   213 QLVMHFDFLSNSMERHELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNF------M 271
            ||.:..|  :|...:|:     ::.:..:.:||..|....:....::.:......:||      :
Mosquito   217 QLTLLID--NNHTGQHD-----EEIADIIKEIVLKHLEHTKYMTDMDKLLKKQFFINFGCMIFEL 274

  Fly   272 VSSFVICFVGFQMTVGVP--PDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWY 334
            |:|..|       .|.||  |.:.:.|.     ..:|:::.|..|..::..:.......||..||
Mosquito   275 VASLAI-------VVRVPWYPGMAICLI-----CTNQLFINCALGTFLSSKNEKLVEEIYNVNWY 327

  Fly   335 KADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLR 385
            ....::::.|..|:..||....| :..|..|......::.:..|.:..:|:
Mosquito   328 GLTTKHQKTLQQILLTSQHPVVL-SDGFSPIDLFNFVEIYKKIYSYLMVLQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 48/237 (20%)
GPROR23XP_317710.1 7tm_6 108..370 CDD:251636 48/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.