DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR6

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_316227.4 Gene:GPROR6 / 1276835 VectorBaseID:AGAP006167 Length:405 Species:Anopheles gambiae


Alignment Length:449 Identity:96/449 - (21%)
Similarity:178/449 - (39%) Gaps:115/449 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKLMKYASFFYTAVGI----RPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAF-MD 61
            |:.::..:.....:||    .||..|....:.:   :..|.::.:.|::..:.|.||:...| .|
Mosquito     7 EETLRNTNLMLLMMGIPPCEEPYPPGVLPSLKR---NAGFIASFLLLAYTTIGELIYLKQMFERD 68

  Fly    62 NKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCS- 125
            ..|||.......||:.|:|:.||..:...:..|.||:...:..:.:.::....:      ..|. 
Mosquito    69 VTFLEVTFQAPCIGYCTIGVLKMVILARGRNTIAELVGLFRAKWTSAIVTGAHW------AVCED 127

  Fly   126 ------RISLIYSLLYSVLIWTFNLFCVMEYWVY-----DKWLNIRVVGKQLPYLMYIPW----- 174
                  |::.:.:|...|:...|.:..:.| .:|     .:|      .:||.:.::.|:     
Mosquito   128 TMRPAIRVTSVTALANVVMGIAFTILPIAE-MIYTHHYTGRW------NRQLAFNIWWPFDVLGG 185

  Fly   175 -KWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNS------MERHELSG 232
             |:.  |..|||..   ..|:|.....::.|.|.|.:|..|.|.|..|:::      :......|
Mosquito   186 VKYY--WFVYPLYV---VIGFTGIIIHMAFDCLFCILAAHLCMQFRILAHNFGHVVEVANGAREG 245

  Fly   233 DWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPD------ 291
            |....|| |.|.:|.|:.:                            :|::   |.|.|      
Mosquito   246 DSGSTSR-LRDAIRIHQEL----------------------------IGYE---GTPLDAGVNQW 278

  Fly   292 ----IVVKLFLFLVSSMSQVYLICHYGQLVADA----------------------SYGFSVATYN 330
                ::||..||::..:.::.::|.||:.:.::                      |.|...|.|.
Mosquito   279 RNGYMLVKFVLFMLCFLIELLMLCAYGEDIVESVRHQAVMSESRVIEAFAFKTHQSLGVIDAAYG 343

  Fly   331 QKWYK-ADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTMY 388
            .:||: ..|.:.|:::.||.|||:...|.|.....|..||.:.:||.|:.:|.||:|:|
Mosquito   344 CEWYREGSVAFHRSVLQIIHRSQQSVILTAWKIWPIQMSTFSQILQASWSYFTLLKTVY 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 77/370 (21%)
GPROR6XP_316227.4 7tm_6 84..391 CDD:251636 72/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.