DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR33

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_001688726.1 Gene:GPROR33 / 1276429 VectorBaseID:AGAP005760 Length:451 Species:Anopheles gambiae


Alignment Length:123 Identity:35/123 - (28%)
Similarity:55/123 - (44%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LLLNFMVSSFVICFVGFQ-MTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATY 329
            ::..|:.|..:||...|: |.....|..:|:...::::...||::...:|..|.:.|.|.|.||.
Mosquito   327 IMAQFVCSMLIICLTAFELMFAKGDPMQMVRFGAYMLAGFYQVFVWSFFGNRVTNMSTGISDATI 391

  Fly   330 NQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            :..|.......|:.|.....||||...:.......:|..|...:|..||..|.|||||
Mosquito   392 SCNWIVLADGLKKDLRFTTMRSQKPFVIDVYWLFPLTYETFIAILSRSYSIFTLLRTM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 27/112 (24%)
GPROR33XP_001688726.1 7tm_6 <315..440 CDD:251636 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.