DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR43

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_314477.1 Gene:GPROR43 / 1275234 VectorBaseID:AGAP010504 Length:386 Species:Anopheles gambiae


Alignment Length:385 Identity:80/385 - (20%)
Similarity:164/385 - (42%) Gaps:61/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFF-IRWK 90
            |.|.|.| :.|:.  :::|.:|...:::.:...:| |.:|:.   :..|....|::|.:. :|::
Mosquito    34 KPNILTF-LAFFG--LSISLIGEVYTVWYFWPILD-KLMESA---AIFGVFIQGLAKFYIALRYR 91

  Fly    91 KTAITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLL---YSVLIWTFNLFCVMEYWV 152
            | ....:.|.| :::.......|:.|..:.| ..:||.|:..|:   :|:.|.|..:..|.:|.:
Mosquito    92 K-FFEAMYNRL-DLFHYEYRNHEKNNATLLL-LMNRICLLRKLITSQFSISILTLMVTPVAQYIL 153

  Fly   153 YDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPL-LFSQNFAGYTSAAGQISTDVLLCAVATQLVM 216
            ..:        :.|.|.:.:|:...:..|:|.| |..|.:......||..:.:.:|....|.:..
Mosquito   154 KGE--------RFLVYTIILPFTDPEITSHYLLNLVVQYYLLIVGLAGFSAAESVLILFVTSVAG 210

  Fly   217 HFDFLSNSM-ERHELSGDWKKDSR-------FLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVS 273
            :.|.|.|.: |.:.|..| .::||       .|.:||..|:|:|...|.::..:.:...:....|
Mosquito   211 YADVLKNKINEMNTLLLD-AQNSRDRTSVKLKLREIVLLHQRVLEYEDDLDKRYYLNNWVQVASS 274

  Fly   274 SFVI------CFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQK 332
            .|.:      |:|....|          ::...::.:.|::.:|..|.:::..:.....|.|:..
Mosquito   275 IFNLTGALFGCYVSNSFT----------MYALAITIVIQLFELCLLGTILSIKNEEIEHAFYDSL 329

  Fly   333 WYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDL-----LQISYKFFALLRTM 387
            ||..|...|:..:|:..:.|...        ::|.::|..|     :.|..|.:||...|
Mosquito   330 WYLMDHSEKKDFLIMFHKCQHAK--------EMTVASMAPLNIVLFIAIMQKIYALAMMM 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 67/337 (20%)
GPROR43XP_314477.1 7tm_6 67..375 CDD:251636 68/340 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.