DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and GPROR52

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_310903.1 Gene:GPROR52 / 1272036 VectorBaseID:AGAP000230 Length:387 Species:Anopheles gambiae


Alignment Length:284 Identity:66/284 - (23%)
Similarity:123/284 - (43%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SVLIWTFNLFCVMEYWVYD-KWLNIRVVGKQLPYLMYI--PWKWQDNWSYYPLLFSQNFAGYTSA 197
            :||:....::.|:.:.||: ..|:.:.:.:...||:..  |..|..:....|:.|  |..| ...
Mosquito   111 NVLMLALMVYGVLNFVVYEASGLHWQEIFRMPDYLLATNRPLTWTLHLIMRPMTF--NGLG-AFI 172

  Fly   198 AGQISTDVLLCAVATQLVM---HFDFLSNSMERH-ELSGD------WKKDSRFLVDIVRYHERIL 252
            |..:|...:|..:..:|::   .||.|...:||| :.:|.      |::.:|.|...||.|..:|
Mosquito   173 ATFVSIHTMLTVLHAELLLVEFAFDGLLERVERHVQAAGAQESPLLWQQFNRELGRCVREHCVVL 237

  Fly   253 RLSDAVNDI--FGIPL-----LLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLI 310
            :....||.:  |.|.:     ||:..:.:|.|.:.|...       :.|.:.:|.|..:.:.|..
Mosquito   238 KQVREVNRVHSFSITVQYYTALLSLAIDAFFISYYGLNF-------VSVCVSIFSVLLVFEWYYC 295

  Fly   311 CHYGQLVADAS-----YGFSVATYNQKW---------YKADVR-YKRALVIIIARSQKVTFLKAT 360
            |   :||.|..     .|:::  ||.||         ..|.:| ::..|.||:..:|:...|:.:
Mosquito   296 C---KLVEDLQATNKRIGWTL--YNDKWSDWLQYGREQPAALREFRTTLSIILLATQRSLSLRGS 355

  Fly   361 IFLDITRSTMTDLLQISYKFFALL 384
            ..::::..|...:|:.||.....|
Mosquito   356 DIVEVSWQTFASMLKTSYSVMMFL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 63/276 (23%)
GPROR52XP_310903.1 7tm_6 60..373 CDD:251636 63/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.