DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and AgaP_AGAP009411

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_310089.2 Gene:AgaP_AGAP009411 / 1271316 VectorBaseID:AGAP009411 Length:248 Species:Anopheles gambiae


Alignment Length:260 Identity:57/260 - (21%)
Similarity:110/260 - (42%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 NIRVVGKQLPYLMYIP-----WKWQDNWS--YYPLLFS------QNFAGYTSAAG--QISTDVLL 207
            ::.|....:..:.|.|     :.|.||.|  |....||      ...|.|.:|..  .|.|.:..
Mosquito    10 SVSVENGSVQSIQYYPNLEESFYWLDNRSSVYGYATFSIVALLVFTVASYNNATKLLTILTTIKY 74

  Fly   208 CAVATQLV-MHFDFL----SNSMERHELSGDWKKDSRFLVDIVRYHERILR----LSDAVNDIFG 263
            |....||| :..|.|    ||:::|.            |..:::.|:|.:|    |:..::.:..
Mosquito    75 CNTLLQLVIIEVDNLNHATSNAIDRE------------LKQVIQLHQRAVRCVALLNQTLSFVMT 127

  Fly   264 IPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMS-QVYLICHY-------GQLVADA 320
            :.|.|..:...|.:.::   :|||:  |:.....|.::.:|: :::..|.:       |.|:|..
Mosquito   128 VQLALCILTWCFTLLYI---LTVGL--DVTGMNGLLIMFNMTLEMFGYCFFCTELATTGTLIACQ 187

  Fly   321 SYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLR 385
            ||.|       :|.:.|.:.::.:..|:||||....:.|..|:.:.......:::.:|..|.:|:
Mosquito   188 SYEF-------RWEEHDPKIQKMISTIVARSQLPLRITACGFITVNVELFAKVVKTTYSVFIVLK 245

  Fly   386  385
            Mosquito   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 54/251 (22%)
AgaP_AGAP009411XP_310089.2 7tm_6 <78..238 CDD:251636 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.