DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and AgaP_AGAP012854

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_024667068.1 Gene:AgaP_AGAP012854 / 1267890 VectorBaseID:AGAP012854 Length:389 Species:Anopheles gambiae


Alignment Length:333 Identity:72/333 - (21%)
Similarity:133/333 - (39%) Gaps:77/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLG------- 122
            ||.....:.:.|.:.....|....:::.....|:::|:::  ..|:.::   ||..||       
Mosquito    78 LEIAVRTAELMFESNAFFGMLMFSFQRDNYERLVHQLQDL--AALVLQD---LPTELGEYLISVN 137

  Fly   123 -TCSRISLIY--------SLLYSVLIWT--FNLFCV------------MEYWVYDKWLNIRVVGK 164
             ...|.|.||        :..:.:.:||  ...|.|            :|..:|  :|:||.  .
Mosquito   138 RRVDRFSKIYCCCHFSMATFFWFMPVWTTYSAYFAVRNSTEPVEHVLHLEEELY--FLHIRT--S 198

  Fly   165 QLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSN-SMERH 228
            ...|..|:...|       |.:::..|.|.|... .|.::|..|:...:||.....|:. :.:|.
Mosquito   199 MAHYTFYVAIMW-------PTIYTLGFTGGTKLL-TIFSNVKYCSAMLKLVALRHCLARVAQDRA 255

  Fly   229 ELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVIC-------FVGFQMTV 286
            |         :.|.:|:..|:|:|.....:...|.....:.|:..:.:.|       ..||..||
Mosquito   256 E---------KELNEIISMHQRVLDCVFLLETTFRWVFFVQFIQCTMIWCSLILYIAVTGFSSTV 311

  Fly   287 GVPPDIVVKLFLFLVSSMSQVYLICHYG-QLVADA-----SYGFSVATYNQKWYKADVRYKRALV 345
            .   ::.|::.|..|    :.|..|::| .|..:.     |||.::|.|:.:|||..:..:|.|.
Mosquito   312 A---NVCVQIILVTV----ETYGYCYFGTDLTTEVLWIPFSYGVALAIYDSEWYKFSISMRRKLR 369

  Fly   346 IIIARSQK 353
            :::.||||
Mosquito   370 LLLQRSQK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 72/333 (22%)
AgaP_AGAP012854XP_024667068.1 7tm_6 92..386 CDD:251636 69/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.