DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and AgaP_AGAP013396

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_003436373.1 Gene:AgaP_AGAP013396 / 11175913 VectorBaseID:AGAP013396 Length:158 Species:Anopheles gambiae


Alignment Length:174 Identity:45/174 - (25%)
Similarity:74/174 - (42%) Gaps:27/174 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 DVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLL 268
            |..|..|..|...|.|...|.:  .||..|.|:.:|.:.:..:.|            .|.:    
Mosquito     7 DAKLGTVQWQQTAHLDAELNRI--IELHIDTKRFARVIYETYQMH------------FFSM---- 53

  Fly   269 NFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKW 333
             |.|..||||..   |.| |..|....|..|.::|..|:::||..|.::...|.....:.|..:|
Mosquito    54 -FSVLCFVICMC---MNV-VARDPRSTLIPFGLASTGQLFVICMLGNVLYIVSDRLKDSVYGIRW 113

  Fly   334 YKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQIS 377
            |:..|..::.|:.::|.:|....:.| :|:.:   |||..:.:|
Mosquito   114 YRCTVSQQKRLLFLLANAQPEIVMGA-VFIPV---TMTSFVTVS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 45/174 (26%)
AgaP_AGAP013396XP_003436373.1 7tm_6 <9..152 CDD:251636 43/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.