DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp85a and Obp93a

DIOPT Version :9

Sequence 1:NP_001334691.1 Gene:Obp85a / 41006 FlyBaseID:FBgn0037589 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster


Alignment Length:183 Identity:35/183 - (19%)
Similarity:74/183 - (40%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CCQLTRPSLDKGNSECRKSL-------------NLPAHRKFNFAELYTINMCIEECNFIGCGYIE 68
            ||.:.:.  ||..:.|||||             ||.:.:       ..::.||.||:|...|:: 
  Fly    37 CCDVQKN--DKAINSCRKSLLGNNSTNSNGEVRNLKSDK-------VALHACIAECSFRTNGFL- 91

  Fly    69 IDPPFRLDLANIRTNLQTI--APQPQNESIP----FLVDAYRKCELFRSSHGRRFTLHLPDIEFI 127
                    |:|...|.|.:  :.|.:.::.|    .::.:...|    :.:.|:   .:.:.:::
  Fly    92 --------LSNGTVNTQALQKSYQQRYKNDPNMSQLMLKSLNSC----TDYARK---RVQEFQWM 141

  Fly   128 EE--PCNPFALQITICVRIHAMQKCPSEFYVDSDECRLAREYFTQCVGDIETN 178
            .:  .|:.:...:..||.......||:..:.::.:|....:|...| .|:.:|
  Fly   142 PKKGDCDFYPATLLACVMEKVYINCPTSKWKNTSDCTAMWKYLVAC-DDVASN 193



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.