DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp85a and Obp47b

DIOPT Version :9

Sequence 1:NP_001334691.1 Gene:Obp85a / 41006 FlyBaseID:FBgn0037589 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster


Alignment Length:203 Identity:50/203 - (24%)
Similarity:86/203 - (42%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPGS--VVFSMFDL---------SIKC---CQLTRPSL-------DKGNSEC-RKSLNLPAHRK 43
            |||..  |:|:...|         :|.|   .||..|:|       |:...:| ::.|.....:|
  Fly     1 MSPSQLLVIFASLALNTRLVFGQATIDCQRPPQLVDPALCCKDGGRDQVAEQCAQRILGTANGQK 65

  Fly    44 FNFAELYTINMCIEECNFIGCGYIEIDPPFRLDLANIRTNLQTIAPQPQNES--IPFLVDAYRKC 106
            ...........|:.||......|  ||.|.:|:|||||::|   :.:..|::  :..:..|:.||
  Fly    66 AGGPPSLDTAACLAECILTSSKY--IDEPQKLNLANIRSDL---SAKFSNDTLYVETMTMAFSKC 125

  Fly   107 ELFRSSHGRRFTLHLPDIEFIEEP--------CNPFALQITICVRIHAMQKCPSEFYVDSDECRL 163
            |   ....||..:.:...:.:::.        |:||:..:..|..:...:.||...:..:.:|.|
  Fly   126 E---PQSQRRLAMIMQQQQQVQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRWTPNAQCTL 187

  Fly   164 AREYFTQC 171
            |:.|.|||
  Fly   188 AKAYVTQC 195



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.