DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp85a and Obp50c

DIOPT Version :9

Sequence 1:NP_001334691.1 Gene:Obp85a / 41006 FlyBaseID:FBgn0037589 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_725387.3 Gene:Obp50c / 246434 FlyBaseID:FBgn0050072 Length:185 Species:Drosophila melanogaster


Alignment Length:166 Identity:40/166 - (24%)
Similarity:64/166 - (38%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FDLSIKCCQLTRPSLDKGNSECRKSLNLPAHRKFNFAELYTINMCIEECNFIGCGYIEIDPPFRL 75
            |::...||.......|:..|:|.|.:.:.|.|         |:.|:.||.|.....: :|.....
  Fly    31 FNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPR---------ISPCLYECIFNKTNTV-VDGAIHP 85

  Fly    76 DLANIRTNLQTIAPQPQNESIPF-----LVDAYRKCELFRSSHGRRFTLHLPDIEFIEEPCNPFA 135
            |  |.|..|:.:......|...|     ..|:.::....|.|..:|.|          |.|:||:
  Fly    86 D--NARLMLEKLFGNQDFEEAYFNGLMGCSDSVQEMISNRRSRPQRKT----------EQCSPFS 138

  Fly   136 LQITICVRIHAMQKCPSEFYVDSDECRLAREYFTQC 171
            |...||.:.:....|||..:..::.|.:||.....|
  Fly   139 LFYGICAQRYVFNHCPSSSWSGTESCEMARLQNMNC 174



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016779
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.