DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG1792

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:331 Identity:82/331 - (24%)
Similarity:128/331 - (38%) Gaps:50/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAAKFRKICVESEKLRDMAPEI-NIDTAEP 94
            |:::.|.|...||    ..:..|.::|..|..:|..|..||:..:.::|....:|.: |.:..|.
  Fly    32 QIEVLTGLFLLGG----PGNELPPFICSPCELDLQTAIAFRERVIRTQKTLQESPNLGNAELIES 92

  Fly    95 LA---------SEEIIIIDPSDYIEQLSAVEDPENEPIGVSRWNCQHCGAGFQLSEVLRRHIQ-- 148
            .|         :||:..|:..|.:.:...:|:.| ||..:...|.|.........:.|||..:  
  Fly    93 FAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEETE-EPYEICEQNEQPQVKVPAQEKKLRRSTKTT 156

  Fly   149 -EVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCL--ECGKCLQSASSLASHIRLHT 210
             .|..|:...|..:..|  |:............|..:|...|:  :||:.....|:...|:..||
  Fly   157 PTVFTSVKFADNSQATR--TQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHT 219

  Fly   211 DEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCN 275
            ....|.||||::.|.|...|..||..|......:|.:|...:..:|...:|...|||       |
  Fly   220 GVKSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHT-------N 277

  Fly   276 VYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRA 340
            |                     :|:.|:..:|.||..|.|:.|...|||.|...|..|:..|.|.
  Fly   278 V---------------------KPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRR 321

  Fly   341 GQLRKH 346
            ..|..|
  Fly   322 SHLTSH 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 12/48 (25%)
C2H2 Zn finger 159..179 CDD:275368 2/19 (11%)
COG5048 184..>250 CDD:227381 21/67 (31%)
C2H2 Zn finger 189..209 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
C2H2 Zn finger 245..262 CDD:275368 3/16 (19%)
C2H2 Zn finger 274..294 CDD:275368 2/19 (11%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..339 CDD:290200 9/23 (39%)
C2H2 Zn finger 330..350 CDD:275368 6/17 (35%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 13/51 (25%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
C2H2 Zn finger 226..243 CDD:275368 7/16 (44%)
C2H2 Zn finger 254..275 CDD:275368 4/20 (20%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 9/23 (39%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.