DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG4936

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:477 Identity:122/477 - (25%)
Similarity:176/477 - (36%) Gaps:139/477 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLKQ-DELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAAKFRKI 73
            |||||:| .|.:..|:.  ::.:.||..::..|||:.:.:.|..|..:|::|...|.:|.|||:.
  Fly    23 CRVCLQQPKEPMASIFN--DDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRET 85

  Fly    74 C---------------VE--------SEKLRDMAPEINIDTA--EPLASE--EIIIIDPSDYIEQ 111
            |               ||        ||....:.|:::.|.|  ||...|  |.:.:|.|.|.|.
  Fly    86 CQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEA 150

  Fly   112 LSAVEDP------------------------ENEPIG-------------------VSRWNCQHC 133
            ..|.|..                        :||.:.                   :......|.
  Fly   151 DDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYDHE 215

  Fly   134 GAGFQLSEVLR--------RHIQ-------------------------EVHASITIIDCRER--- 162
            .|...|||:..        .|.|                         .|.|||...:..:|   
  Fly   216 MADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVN 280

  Fly   163 -RRIFTKLGCYQVHNCSYAKTPKRGH---------------------KCLECGKCL----QSASS 201
             ||..|......|.: |.:||..||:                     |.:..|:.|    ....:
  Fly   281 PRRSATSTASVAVES-STSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKT 344

  Fly   202 LASHIRLHTD--EWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVESSNLRRHIVN 264
            ...|..|..|  |:.:.||.|...:.:...|..|.:.|..|..|:|..||..|.::..|.|| :|
  Fly   345 KGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARH-MN 408

  Fly   265 RHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHERIHTGERLHR 329
            .||..||:.|:....:|:.:.....|.|.:|.||||.|....|.|.....||.|:.|||||:.|.
  Fly   409 THTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHV 473

  Fly   330 CQVCEKPFTRAGQLRKHALRHE 351
            |.||.|.|.:|.:||.|.:.||
  Fly   474 CDVCGKGFPQAYKLRNHRVIHE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 27/93 (29%)
C2H2 Zn finger 159..179 CDD:275368 5/23 (22%)
COG5048 184..>250 CDD:227381 19/92 (21%)
C2H2 Zn finger 189..209 CDD:275368 3/23 (13%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
C2H2 Zn finger 245..262 CDD:275368 6/16 (38%)
C2H2 Zn finger 274..294 CDD:275368 4/19 (21%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..339 CDD:290200 14/23 (61%)
C2H2 Zn finger 330..350 CDD:275368 9/19 (47%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 23/73 (32%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 9/23 (39%)
COG5048 386..>447 CDD:227381 22/61 (36%)
C2H2 Zn finger 390..410 CDD:275368 8/20 (40%)
zf-H2C2_2 403..426 CDD:290200 9/23 (39%)
C2H2 Zn finger 418..438 CDD:275368 4/19 (21%)
zf-H2C2_2 432..455 CDD:290200 10/22 (45%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.