DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and Odj

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:390 Identity:87/390 - (22%)
Similarity:142/390 - (36%) Gaps:107/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLKQDELLVDIY-----EIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAAK 69
            ||:|.::      |:     .|.|:....:...:|...|:::...::.|.::|..|..:|..|..
  Fly     5 CRICGER------IFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVA 63

  Fly    70 FRKICVES-----EKLRDMA-------PEINIDTAEPLASEEII--IIDPSDYIEQLSAVED--- 117
            ||:.|:|:     :::...|       ||::...::||...|::  .:|..|..|.|...:|   
  Fly    64 FRQRCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDDDKDLMD 128

  Fly   118 ------PENEPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTK-LGCYQVH 175
                  .:.:||             .:.....:..|::.:     ...|:..|:..| |....|.
  Fly   129 DDKDFLEDEKPI-------------LRYPPAKKIRIEDQN-----FPNRQSPRVRVKRLRVPVVE 175

  Fly   176 NCSYAKTPKRGH--------------------KCLECGKCLQSASSLASHIRLHTDEWPFTCDQC 220
            .......|.|.|                    .|.:||......|::..|...|.:| .|:||:|
  Fly   176 KADSPPPPPREHVRKPRKRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEE-KFSCDEC 239

  Fly   221 AKAFRTNGALEVHQR-RHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRV 284
            .:.|.|...|.:|.| .||....:.|..||.||..|.:..||....|..|..|.|.:        
  Fly   240 GRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKI-------- 296

  Fly   285 YMLELHLRTNTGERPYACQHRDKRF-AQLGVLKIHERIHTGER--LHRCQVCEKPFTRAGQLRKH 346
                             |   .||| ::.|.|| ||..|..::  :|.|..|.|.|..|..|.:|
  Fly   297 -----------------C---GKRFNSEKGRLK-HEEGHKSDQPDVHICLTCNKEFKEAQFLHRH 340

  Fly   347  346
              Fly   341  340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 17/79 (22%)
C2H2 Zn finger 159..179 CDD:275368 5/20 (25%)
COG5048 184..>250 CDD:227381 22/86 (26%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
C2H2 Zn finger 245..262 CDD:275368 7/16 (44%)
C2H2 Zn finger 274..294 CDD:275368 1/19 (5%)
C2H2 Zn finger 302..322 CDD:275368 9/20 (45%)
zf-H2C2_2 315..339 CDD:290200 10/25 (40%)
C2H2 Zn finger 330..350 CDD:275368 7/17 (41%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 17/77 (22%)
COG5048 <202..343 CDD:227381 48/169 (28%)
C2H2 Zn finger 209..229 CDD:275368 5/19 (26%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 249..274 CDD:290200 10/24 (42%)
C2H2 Zn finger 265..283 CDD:275368 8/17 (47%)
C2H2 Zn finger 298..314 CDD:275368 8/16 (50%)
zf-C2H2_jaz 322..347 CDD:288983 8/19 (42%)
C2H2 Zn finger 324..343 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.