DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG6654

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:433 Identity:111/433 - (25%)
Similarity:160/433 - (36%) Gaps:117/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YEIVEE-MQVDLCTLLETCGGIKVDRR-------------DVQPMYLCQECTNELLIAAKFRKIC 74
            ||:.:| ::.....:|:..|.:|.::.             |.:.....:||.     .|.|..:.
  Fly   155 YELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECN-----LAIFEGVD 214

  Fly    75 VESEKLRDMAPEI--------------NIDTAEPLASEE-------------------------- 99
            .|:|.:...||::              |.....|:.|:|                          
  Fly   215 NEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQ 279

  Fly   100 -IIIIDPSDYIEQLSAVEDPENEPIGVSR--------------------------WNCQHCGAGF 137
             :....|||      |...|:...:|..|                          ::|..|.|||
  Fly   280 DVPATPPSD------AEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGF 338

  Fly   138 QLSEVLRRHIQEVHASITIIDCRERRRIFTK---LGCYQ----VHNC-----------SYAKTPK 184
            .:.:.|..|.::.........|.|..::|..   |..:|    .|||           :.:|...
  Fly   339 AVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMV 403

  Fly   185 RGHK------CLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQH 243
            :|||      |..|.|.....|:|..|:|:||.|.||.|:.|.|:|..|..|..|:.||.:....
  Fly   404 QGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSF 468

  Fly   244 KCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKR 308
            ||..|...||..:.|..| ...||.::|..|.|....|:....|..|.|.:||||||||.....|
  Fly   469 KCELCPHSFVTKAELTSH-ARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMR 532

  Fly   309 FAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHE 351
            |..|.|||.|.|.|||||.:.|..|.|.||:.|..:.|...|:
  Fly   533 FTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQ 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 13/69 (19%)
C2H2 Zn finger 159..179 CDD:275368 8/37 (22%)
COG5048 184..>250 CDD:227381 27/71 (38%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 245..262 CDD:275368 5/16 (31%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
C2H2 Zn finger 302..322 CDD:275368 9/19 (47%)
zf-H2C2_2 315..339 CDD:290200 13/23 (57%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 7/22 (32%)
COG5048 <357..570 CDD:227381 76/213 (36%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..406 CDD:275370 2/20 (10%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
zf-H2C2_2 427..451 CDD:290200 12/23 (52%)
C2H2 Zn finger 442..490 CDD:275368 16/48 (33%)
C2H2 Zn finger 470..487 CDD:275368 6/17 (35%)
zf-H2C2_2 482..507 CDD:290200 8/25 (32%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 12/23 (52%)
C2H2 Zn finger 526..546 CDD:275368 9/19 (47%)
zf-H2C2_2 539..563 CDD:290200 13/23 (57%)
C2H2 Zn finger 554..574 CDD:275368 7/19 (37%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I3381
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.