DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG6689

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:450 Identity:99/450 - (22%)
Similarity:167/450 - (37%) Gaps:127/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPPSGE------FRCRVCLKQ---DELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYL 56
            :.|.|||      .:||.|...   |....|:::....:   |...:|...|:.:..:..:|..:
  Fly   152 LDPLSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSV---LLFHIEVISGVWISHKPDEPRLM 213

  Fly    57 CQECTNELLIAAKFRKICVESE-KLRDMAP-----EINIDTAEPLASEEIIIIDP---------- 105
            |..|.:.|..|..||::|:.:| ||....|     :|..:...|::|:..:|.|.          
  Fly   214 CPACKSALDQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEIED 278

  Fly   106 --SDYIEQLSAVEDPEN--------------EPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASI 154
              .|::|..:..:|..:              :|:.|:      .||.. ..|:|.::..      
  Fly   279 AGGDHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVA------LGAKI-FKELLDQYTG------ 330

  Fly   155 TIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCLECGKCLQSAS-------SLASHIRLHTDE 212
                 :|:.|:  :.|      ...|..||...|.....|..:||:       :|....:|....
  Fly   331 -----KEKARL--RKG------APIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKP 382

  Fly   213 WPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERP------ 271
            ..|.||||.:|||.:..|.:|..||.:...::|..|.:.|.::.....||..||..|.|      
  Fly   383 PNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFC 447

  Fly   272 ------------------------------------------HLCNVYQRSFSRVYMLELHLRTN 294
                                                      :.|.:.|:.::..|.|..|::::
  Fly   448 SETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSH 512

  Fly   295 TGERPYACQHRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHETGQ 354
            |....|.||...|.::....||.||..|. :|..:|.||.|.|.:..:||:|.|.| ||:
  Fly   513 TDANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIH-TGE 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 17/73 (23%)
C2H2 Zn finger 159..179 CDD:275368 3/19 (16%)
COG5048 184..>250 CDD:227381 21/72 (29%)
C2H2 Zn finger 189..209 CDD:275368 4/26 (15%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
C2H2 Zn finger 245..262 CDD:275368 3/16 (19%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..339 CDD:290200 11/23 (48%)
C2H2 Zn finger 330..350 CDD:275368 9/19 (47%)
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 19/75 (25%)
zf-C2H2 385..407 CDD:278523 10/21 (48%)
C2H2 Zn finger 387..407 CDD:275368 9/19 (47%)
zf-H2C2_2 399..422 CDD:290200 6/22 (27%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 0/15 (0%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 547..567 CDD:275368 9/19 (47%)
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.