DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and nom

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:367 Identity:80/367 - (21%)
Similarity:129/367 - (35%) Gaps:85/367 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLKQDELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAAKFRKIC 74
            |||| .:..|.....|:.:..:.|:...::...||.:.:....|..:|..|..:|..|..||:.|
  Fly     6 CRVC-GRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFRRQC 69

  Fly    75 V------------------ESEKLRDMAPEINIDTAE--------PLASEEIIIIDPSDYIEQLS 113
            :                  |.:|:....|.....|.:        ||...:|::.:.|......|
  Fly    70 ILQQKKWVPLLQSDKVGASEEKKVEPNDPSTKKKTTKRRRGRPRMPLEIVDIVVTNESKASAGES 134

  Fly   114 AVEDPENEPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCS 178
            ...|..::|:.:|.                .....:...::..||..:..      |....|:..
  Fly   135 VGGDEFDQPVEISN----------------EPDATDSDVNLEEIDLPDED------GLESDHDLP 177

  Fly   179 YAKTPKRGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQH 243
            ..:.    |||..||....:.|||..|...|....|:.|.:|.|.                    
  Fly   178 NVQI----HKCDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKT-------------------- 218

  Fly   244 KCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKR 308
                    |:.:|.|:.|.:..||.|.|..|....|.:..|...:.|.|.:|.|||:.|....|.
  Fly   219 --------FLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKA 275

  Fly   309 FAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRH 350
            |.:..:||.|..:|...|.:.|.||::.|:    |:||...|
  Fly   276 FTRTCILKAHMAVHQVVRKYSCDVCDRSFS----LKKHLATH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 18/87 (21%)
C2H2 Zn finger 159..179 CDD:275368 2/19 (11%)
COG5048 184..>250 CDD:227381 14/65 (22%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..237 CDD:275368 3/19 (16%)
C2H2 Zn finger 245..262 CDD:275368 3/16 (19%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
zf-H2C2_2 315..339 CDD:290200 9/23 (39%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 17/70 (24%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
C2H2 Zn finger 212..261 CDD:275368 16/76 (21%)
zf-H2C2_2 255..278 CDD:290200 9/22 (41%)
C2H2 Zn finger 269..289 CDD:275368 6/19 (32%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.