DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and Zif

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:365 Identity:93/365 - (25%)
Similarity:154/365 - (42%) Gaps:49/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLKQDELLVDIYEIVEEMQVDLCTLLETCGGIKV----DRRDVQPMYLCQECTNELLIAAKF 70
            |||||.|.|.|..:.||.||.:.....:|....|:..    ||..: |..:|:.|..||.:|.:|
  Fly    10 CRVCLAQSERLQRLDEIREEGEESPNEMLIQLLGVSYSNLNDREHI-PDGICKSCKVELNMAYQF 73

  Fly    71 RKICVESE-KLRDMAPEINI------------DTAEPLASEEIIIIDPSDYIEQLSAVEDPENEP 122
            |:..:..: ::.:...|:.:            |.::....||:.|::.:...|:....|....|.
  Fly    74 REKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEMYILEETTTGEEEHQEEKGHEEY 138

  Fly   123 IGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGH 187
            :.|...:.|.| .|..:..:...:..|:::..|.|.....::              |.:||.:..
  Fly   139 LEVDTSDQQEC-IGDTIEYLEDNYTIEMNSDQTEIVLESEKQ--------------YEETPSQQL 188

  Fly   188 KCLECGKCLQSASSLASHIRLH-----------TDEWPFTCDQCAKAFRTNGALEVHQRRHKQVL 241
            ...|..|    ||..|...|:.           |::..:.||.|...:...|.:..|:|||..:.
  Fly   189 ALQEAAK----ASLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRMMEHRRRHDGIC 249

  Fly   242 QHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRD 306
            |:.|..|...|.....||:|:.: ||..:|:.|:...|.|....:|:.|...:.|.:||.|:..|
  Fly   250 QYACELCDAKFQVREQLRKHMYS-HTGSKPYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCD 313

  Fly   307 KRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKH 346
            |.||....|..||.||:..:|:||..|.|.|.....:|:|
  Fly   314 KAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 24/74 (32%)
C2H2 Zn finger 159..179 CDD:275368 0/19 (0%)
COG5048 184..>250 CDD:227381 18/76 (24%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 245..262 CDD:275368 5/16 (31%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 8/19 (42%)
zf-H2C2_2 315..339 CDD:290200 11/23 (48%)
C2H2 Zn finger 330..350 CDD:275368 6/17 (35%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 24/77 (31%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
COG5048 <250..369 CDD:227381 36/105 (34%)
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
zf-H2C2_2 266..288 CDD:290200 8/22 (36%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
zf-H2C2_2 294..318 CDD:290200 9/23 (39%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.