DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG14667

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:338 Identity:79/338 - (23%)
Similarity:127/338 - (37%) Gaps:80/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCL------KQDELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAA 68
            ||:|.      ::|.      .|...|:......|:...|:::.|....|..:|:.|.:||.:|.
  Fly     7 CRICANKIMGHQRDR------NIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLAT 65

  Fly    69 KFRKICVESEK-LRDMAPE------INID-TAEPLASEEII-------IIDPSDYI--------- 109
            |||:.|:.|:| |.|:..:      :::: ::||| .|::|       ..|...|:         
  Fly    66 KFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPL-DEQLIDADQLETHYDDDQYVCYQGTKEEH 129

  Fly   110 ---EQLSAVEDP-----------------------ENEPIGVSRWN---CQHCGA----GFQLSE 141
               |::...:||                       |.|.....|.|   |..||.    .|..:|
  Fly   130 QDLEEIELDDDPSAAVIAAAEAAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTE 194

  Fly   142 VLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCLECGKCLQSASSLASHI 206
            .|..| |..........|.|..:.|.|....:.|. :......|..:|..|.:...|..:...|.
  Fly   195 HLNGH-QNRRDMNQFFPCPECPQTFNKKALLKQHR-TQVHLINRRFQCTICHEAFASLGAKLRHD 257

  Fly   207 RLHTDEWPFTCDQCAKAFRTNGALEVHQRRH-KQVLQHKCLHCGRGFVESSNLRRHIVNRHTEER 270
            :.|.:|.|:.|.:|...|.:...|:.|...| ||:.:.:|..|...|:    .||.:| .||:..
  Fly   258 KAHKNERPYPCLECGMIFSSVSELQNHFSTHSKQIRKFRCEPCNMDFI----TRRGLV-AHTKTA 317

  Fly   271 PH--LCNVYQRSF 281
            ||  |....|..|
  Fly   318 PHKRLAKYMQDEF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 21/76 (28%)
C2H2 Zn finger 159..179 CDD:275368 5/19 (26%)
COG5048 184..>250 CDD:227381 18/66 (27%)
C2H2 Zn finger 189..209 CDD:275368 4/19 (21%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
C2H2 Zn finger 245..262 CDD:275368 5/16 (31%)
C2H2 Zn finger 274..294 CDD:275368 2/8 (25%)
C2H2 Zn finger 302..322 CDD:275368
zf-H2C2_2 315..339 CDD:290200
C2H2 Zn finger 330..350 CDD:275368
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 22/78 (28%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 5/21 (24%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-C2H2_8 243..313 CDD:292531 20/74 (27%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.