DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG10321

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:281 Identity:60/281 - (21%)
Similarity:104/281 - (37%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GIKVDRRDVQPMYLCQECTNELLIAAKFRKICVESEKLRDMAPEINIDTAEPLASEEIIIIDPSD 107
            |:.::..|.||. .....|:..|.||..|::...:..:.....:.|.:....|.:|         
  Fly   557 GVTLEPCDHQPP-AAGSTTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTE--------- 611

  Fly   108 YIEQLSAVEDPENEPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCY 172
            :|.|       ...|:|..|:.|..|...|:..:.|:.|   :|:....|..             
  Fly   612 FIRQ-------HTSPLGSGRYICHLCSTEFRQFKGLQNH---MHSHTNWIRA------------- 653

  Fly   173 QVHNCSYAKTPKRGHKCLECGKCLQSASSLASHIRLHTDE--WPFTCDQCAKAFRTNGALEVHQR 235
               ||      |:..:|..|.|..:....|..|::.|..|  .|. |..|.:.|::...|..|::
  Fly   654 ---NC------KKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPM-CTICNRTFKSKAILYRHRQ 708

  Fly   236 RHKQVLQHKC--LHCGRGFVESSNLRRHIVNRHTEERPHL--CNVYQRSFSRVYMLELHLRTNTG 296
            .|:| ..:.|  .:|.:.|..:.||:.|:..:|.|....|  |......:..|..|:||:.:...
  Fly   709 THQQ-RAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHVESTDH 772

  Fly   297 ERPYACQHRDKRFAQLGVLKI 317
            ........:|..|:  |.:.|
  Fly   773 SAEVQISGQDDAFS--GAVSI 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 9/36 (25%)
C2H2 Zn finger 159..179 CDD:275368 2/19 (11%)
COG5048 184..>250 CDD:227381 18/69 (26%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
C2H2 Zn finger 245..262 CDD:275368 5/18 (28%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 4/16 (25%)
zf-H2C2_2 315..339 CDD:290200 1/3 (33%)
C2H2 Zn finger 330..350 CDD:275368
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 6/22 (27%)
C2H2 Zn finger 661..681 CDD:275368 5/19 (26%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 6/22 (27%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.