DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7963 and klf-3

DIOPT Version :9

Sequence 1:	NP_649798.3	Gene:	CG7963 / 41001	FlyBaseID:	FBgn0037584	Length:	354	Species:	Drosophila melanogaster
Sequence 2:	NP_001022205.1	Gene:	klf-3 / 191713	WormBaseID:	WBGene00003480	Length:	315	Species:	Caenorhabditis elegans

Alignment Length:	111	Identity:	36/111 - (32%)
Similarity:	55/111 - (49%)	Gaps:	13/111 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   254 ESSNLRRHIVNRHTEERP-------HLCNVYQ---RSFSRVYMLELHLRTNTGERPYAC--QHRD 306
            |.|.|:|.......:..|       |.| .|.   :.:|:...|:.|.||::||:|:.|  |:..
Worm   205 ERSPLQRKSRIESNKRNPTDKKFVVHAC-TYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCS 268

  Fly   307 KRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHET 352
            .:||:...|..|.|.|||::..||.:|::.|.|:..|..|..||.|
Worm   269 WKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRHST 314

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7963	NP_649798.3	zf-AD	10..80	CDD:285071
		C2H2 Zn finger	159..179	CDD:275368
		COG5048	184..>250	CDD:227381
		C2H2 Zn finger	189..209	CDD:275368
		C2H2 Zn finger	217..237	CDD:275368
		C2H2 Zn finger	245..262	CDD:275368	4/7 (57%)
		C2H2 Zn finger	274..294	CDD:275368	6/22 (27%)
		C2H2 Zn finger	302..322	CDD:275368	7/21 (33%)
		zf-H2C2_2	315..339	CDD:290200	10/23 (43%)
		C2H2 Zn finger	330..350	CDD:275368	6/19 (32%)
klf-3	NP_001022205.1	C2H2 Zn finger	235..254	CDD:275368	4/18 (22%)
		C2H2 Zn finger	262..284	CDD:275368	7/21 (33%)
		zf-H2C2_2	276..301	CDD:290200	10/24 (42%)
		C2H2 Zn finger	292..312	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000