| Sequence 1: | NP_649798.3 | Gene: | CG7963 / 41001 | FlyBaseID: | FBgn0037584 | Length: | 354 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001024696.1 | Gene: | lsy-2 / 180522 | WormBaseID: | WBGene00003087 | Length: | 365 | Species: | Caenorhabditis elegans |
| Alignment Length: | 220 | Identity: | 57/220 - (25%) |
|---|---|---|---|
| Similarity: | 83/220 - (37%) | Gaps: | 54/220 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 182 TPKRGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCL 246
Fly 247 HCGRGFVESSNLRRHIVNRHT--EE-----RPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQH 304
Fly 305 RDKRFAQLGV------------------LKIHERIHTGE------------------------RL 327
Fly 328 HRCQVCEKPF-TRAGQLRKHALRHE 351 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7963 | NP_649798.3 | zf-AD | 10..80 | CDD:285071 | |
| C2H2 Zn finger | 159..179 | CDD:275368 | |||
| COG5048 | 184..>250 | CDD:227381 | 24/65 (37%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 245..262 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 2/37 (5%) | ||
| zf-H2C2_2 | 315..339 | CDD:290200 | 7/48 (15%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 8/20 (40%) | ||
| lsy-2 | NP_001024696.1 | zf-C2H2 | 106..128 | CDD:278523 | 9/21 (43%) |
| C2H2 Zn finger | 108..128 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 134..156 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 136..156 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 80..100 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 93..115 | CDD:290200 | 11/21 (52%) | ||
| COG5048 | 102..>156 | CDD:227381 | 19/53 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||