DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9684 and smyd3

DIOPT Version :9

Sequence 1:	NP_649797.2	Gene:	CG9684 / 41000	FlyBaseID:	FBgn0037583	Length:	642	Species:	Drosophila melanogaster
Sequence 2:	NP_001032477.1	Gene:	smyd3 / 569507	ZFINID:	ZDB-GENE-051120-138	Length:	380	Species:	Danio rerio

Alignment Length:	139	Identity:	31/139 - (22%)
Similarity:	49/139 - (35%)	Gaps:	48/139 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 KGKCVHCANAAERV--CQRCGDF-YCSKHCQRQDWLRHRYIC---------IPLPA--------- 60
            |..|..|....|.:  |.:|... ||:..||:|.|..|:..|         ||..:
Zfish    46 KTACQSCLKRGESLSRCSQCKTARYCNVQCQKQAWPDHKRECKCLKHLQPRIPTDSVRLVARIIF 110

  Fly    61 -LVSPNE------YSV---------FQSDRESTLEGACSL--------NADKSVVEASPIPLSRS 101
             |:|.:|      ||:         ...::...|:..|:.        |.|.|.:.:...|:|
Zfish   111 KLLSQSESDQEELYSIAEHQSHLADMSEEKTEGLKHLCTTLQVYLAEENCDLSRLPSGLDPVS-- 173

  Fly   102 PILPDLQCN 110
             :|..:.||
Zfish   174 -LLARVTCN 181

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9684	NP_649797.2	zf-MYND	20..55	CDD:280009	12/37 (32%)
		TUDOR	132..250	CDD:278965
		TUDOR	527..574	CDD:119391
smyd3	NP_001032477.1	zf-MYND	49..87	CDD:280009	12/37 (32%)
		SET	<201..239	CDD:279228
		TPR_12	276..351	CDD:290160
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
ZFIN	0	0.000	Not matched by this tool.
	1	0.960