powered by:
Protein Alignment CG9684 and smyd1a
DIOPT Version :9
Sequence 1: | NP_649797.2 |
Gene: | CG9684 / 41000 |
FlyBaseID: | FBgn0037583 |
Length: | 642 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991103.2 |
Gene: | smyd1a / 321245 |
ZFINID: | ZDB-GENE-030131-9825 |
Length: | 485 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 29/74 - (39%) |
Gaps: | 15/74 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 AGADELAQAKGKCVHCANAAERVC----------QRCGD----FYCSKHCQRQDWLRHRYICIPL 58
||....|:|....|...:.:.:|| .||.. .||.:.|||..|..||..|..:
Zfish 29 AGEVVFAEASFAAVVLDSLSLQVCHSCFRRQVNPHRCAQCKFAHYCDRTCQRAAWDEHRKECSAI 93
Fly 59 PAL-VSPNE 66
..: .:|||
Zfish 94 RNIGKAPNE 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.960 |
|
Return to query results.
Submit another query.