DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9684 and Smyd1

DIOPT Version :9

Sequence 1:NP_649797.2 Gene:CG9684 / 41000 FlyBaseID:FBgn0037583 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001100065.1 Gene:Smyd1 / 297333 RGDID:1305105 Length:490 Species:Rattus norvegicus


Alignment Length:500 Identity:98/500 - (19%)
Similarity:174/500 - (34%) Gaps:137/500 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CVHCANAAERVCQRCGD----FYCSKHCQRQDWLRHRYICIPLPALVS-PNE------YSVFQSD 73
            |..|....||: .|||.    .||.:.||:..||.|:..|..:..... |||      ..:::.:
  Rat    52 CHTCFKRQERL-HRCGQCKFAHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVE 115

  Fly    74 REST-LEGACSLNADKSVVEASPIPLSRSPILPDLQ--CNNAGRSSIIAAKDDIPVS----PPKA 131
            ||.| |...|.::.|                  |||  ..:.|.......:.|:...    ||::
  Rat   116 REGTGLTEGCLVSVD------------------DLQNHVEHFGEEEQKELRVDVDTFLQYWPPQS 162

  Fly   132 IIPPSGAMVYITDFISSNRCYIRDASESAERAFDEVCKKVNTIATLLPRI----KNPPPNRLCLV 192
               ...:|.||:.......|  ...:.|.:|....|.      ..:.|.:    .:..||  |.|
  Rat   163 ---QQFSMQYISHIFGVINC--NGFTLSDQRGLQAVG------VGIFPNLGLVNHDCWPN--CTV 214

  Fly   193 HF-NGMY--VRAKMCKKLR-EVSHLFLVDLGIKHSGPFFDFKDINDELKALPCSSQLVQLKNV-- 251
            .| ||.:  |::....::| |:..|..:..|.:.:..:.||..:::|.:.        |||..  
  Rat   215 IFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLHLSEERRQ--------QLKKQYY 271

  Fly   252 --LNCDYSNDVIAFNSKFVGKKYMATIKKCPGLHLVELVNTEMNFSVNEQLNAFFNSKKLLRNPN 314
              .:|::.       .|.:.......:|:.|          :.:..|.:::..|  ||..|...:
  Rat   272 FDCSCEHC-------QKGLKDDLFLAVKEDP----------KPSQEVVKEMTQF--SKDTLEKID 317

  Fly   315 SAA------ENIKSC--SLEGPQPSHIDQPIAIPAI--ECKKMLTKPEVQNECEEI--------- 360
            .|.      |.:|.|  .||..:|...|..:.:..:  ...::|:..:...|....         
  Rat   318 KARSEGLYHEVVKLCRECLEKQEPVFADTNLYVLRLLSIVSEVLSYLQAFEEASHYARRMVDGYM 382

  Fly   361 -LKQQNSGQID----QSKSTN-------------------VLVTEGASNKMLGFIDLADKATKTD 401
             |...|:.|:.    ::..||                   :|||.|.|:.:..  ||.....:|:
  Rat   383 KLYHHNNAQLGMAVMRAGLTNWHAGHIEVGHGMICKAYAILLVTHGPSHPITK--DLEAMRMQTE 445

  Fly   402 QDTAPKPKDEDVKHSLTQCLTPKANYPLQLPNHKKNLELPVI-HK 445
            .:.....::|.:.|.:.:...  .|.|:|:.....|...|.: ||
  Rat   446 MELRMFRQNEFMYHKMREAAL--NNQPMQVMAEPSNEPAPALFHK 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9684NP_649797.2 zf-MYND 20..55 CDD:280009 14/38 (37%)
TUDOR 132..250 CDD:278965 25/125 (20%)
TUDOR 527..574 CDD:119391
Smyd1NP_001100065.1 zf-MYND 52..90 CDD:280009 14/38 (37%)
SET <194..257 CDD:214614 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.