DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEA1 and MAGE

DIOPT Version :10

Sequence 1:NP_004979.3 Gene:MAGEA1 / 4100 HGNCID:6796 Length:309 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:32 Identity:8/32 - (25%)
Similarity:13/32 - (40%) Gaps:13/32 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    53 IATKVLGTVKWFNVRNGYGFINRNDTKEDVFV 84
            :|.|::..:||             |...|:||
  Fly   100 LAFKLISFIKW-------------DFVTDLFV 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEA1NP_004979.3 MAGE_N 5..89 CDD:463582 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..64 3/10 (30%)
MAGE 109..273 CDD:426270
MAGENP_649702.2 MAGE 30..201 CDD:426270 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.