DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEA1 and MAGE

DIOPT Version :9

Sequence 1:NP_004979.3 Gene:MAGEA1 / 4100 HGNCID:6796 Length:309 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:226 Identity:50/226 - (22%)
Similarity:102/226 - (45%) Gaps:38/226 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   101 VITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASE---SLQLV-------F 155
            |:..||..::.::|.....:.|:...:::            .:.|..||   .|.||       |
  Fly    25 VVDAKVRAILNYILDHTAQKIPIKDKDLI------------AVAGDKSELKKRLPLVTNLLAETF 77

Human   156 GIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQI----MPKTGFLIIVLVMIAMEGGHAPEEEIWE 216
            ||.:...|.|..:::..     :.:.:...:::    .|:...|.|:|:.|.:.|....:.:::.
  Fly    78 GIILTPLDATTKTFICT-----AEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYV 137

Human   217 ELSVMEVYDGREHSAYG-EPRKLLTQDLVQEKYL--EYRQVPDSDPARYEFLWGPRALAETSYVK 278
            .|.::.:|...||..:| ..||.:.:..|:::||  |..|:...|.::..|||||||.||.::.:
  Fly   138 MLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQ 202

Human   279 VLEYVIKVSARVRFFFPSLREAALREEEEGV 309
            ::::..|:..:    .|.:....|...:|||
  Fly   203 MVQFASKLLNQ----HPKVFGHHLSMAQEGV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEA1NP_004979.3 MAGE_N 5..>68 CDD:289225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..64
MAGE 109..273 CDD:279759 39/180 (22%)
MAGENP_649702.2 MAGE 36..201 CDD:279759 41/181 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151968
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.