DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARSA and CG7402

DIOPT Version :9

Sequence 1:XP_016884289.1 Gene:ARSA / 410 HGNCID:713 Length:547 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster


Alignment Length:570 Identity:163/570 - (28%)
Similarity:236/570 - (41%) Gaps:124/570 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     8 SLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCT 72
            |.:|:||.|...:..||||:|..||:|..|:..:|.....|||:|.||..|:.....||| :|||
  Fly    13 SSILSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVP-NLCT 76

Human    73 PSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFL 137
            ||||.||||:.|:..||...|::.....|||..|..:.|:....||.|.:.||||||...:. ..
  Fly    77 PSRATLLTGKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRKD-LT 140

Human   138 PPHQGF-HRF----------------------LGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLV 179
            |..:|| |.|                      .|:.:..|..||      |.|.           
  Fly   141 PTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGLDFRRDLEPC------PEAN----------- 188

Human   180 PIPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASH---HTHYPQFSGQSFA 241
                 ...:.||...     ||:.:...||       :.:|.|: ..||   ||.......|:..
  Fly   189 -----GTYATEAFTS-----EAKRIIEQHD-------KSKPLFM-VLSHLAVHTGNEDSPMQAPE 235

Human   242 ERSGRGP---------FGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRM-SRGGC 296
            |...:.|         :...:..||.:|...:.|:.|.|:|..::::..:|||..|:.: |..|.
  Fly   236 EEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGS 300

Human   297 SGLLRCGKGTTYEGGVREPALAFWP------GHIAPGVTHELASSLDLLPTLAALAGAPLP-NVT 354
            :...|..|.:.:|||:|. |.|.|.      |:::....|    ::|.|||||..||..|| ::.
  Fly   301 NYPYRGQKESPWEGGIRS-AGALWSPLLKERGYVSNQAIH----AVDWLPTLAGAAGVSLPQDLP 360

Human   355 LDGFDLSPLLLGTGK-SPR------QSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGNPSPWIPP 412
            |||.:|.|:|.|..: .||      ..:|.|.||..:        |.||......:|....|:  
  Fly   361 LDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRD--------TLKYVNGSSFKGRYDQWL-- 415

Human   413 PDLLTPPRSP--RSLAPPLALALCTELAPSPG-------SAHSDTTAD-PACHASSSLTAH---E 464
            .:|.|....|  .|....:..:....|..:.|       ...|:.|.. |.....:.|.:|   |
  Fly   416 GELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCE 480

Human   465 P---PLLYDLSKDPGENYNLLGGVAGATPEVLQAL--KQLQLLKAQLDAA 509
            |   |..:||:|||.|.|||    |...|..||.|  :..|:.|..:.:|
  Fly   481 PLKAPCFFDLAKDPCERYNL----AQMYPLQLQQLADELEQIRKTAIPSA 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARSAXP_016884289.1 None
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 133/485 (27%)
4-S 28..436 CDD:293753 131/459 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157183
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.