DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and LIMS3

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001381830.1 Gene:LIMS3 / 96626 HGNCID:30047 Length:398 Species:Homo sapiens


Alignment Length:348 Identity:217/348 - (62%)
Similarity:262/348 - (75%) Gaps:18/348 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YSKAEVVQAANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGR 67
            |:|..:..|    |.:..|.||..||.|.|.||||||||:|.|||||||||:.|.:|:|||||||
Human    58 YAKFNMANA----LASATCERCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGR 118

  Fly    68 KYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHEC 132
            ||||.||.:||||||::||||:||||||||:.||||:||||.||.:.|||.||:||..|.||..|
Human   119 KYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPC 183

  Fly   133 NAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDM 197
            :.:.||...|:|:|||||.:|||:||.|:.:.||..||:|..||.:|.:.|:|:|          
Human   184 HNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKDLTADAQELK---------- 238

  Fly   198 NELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCE 262
            .|||||.||||||:|||||||||||.|||.|:||.||||||||||||||||||||||::||||||
Human   239 GELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCE 303

  Fly   263 THYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKCYDR 327
            |||:||||::||.||:||.|||.:||||||||:.||||.|:||:|.|.||.|.|.|||||.||::
Human   304 THYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKDKFVEIDLKPVCKHCYEK 368

  Fly   328 FPNELRRRL----RTAHEMTMKK 346
            .|.|.:|||    |.|.:...:|
Human   369 MPEEFKRRLAKREREAKDKDKQK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 41/57 (72%)
LIM2_PINCH 82..133 CDD:188718 33/50 (66%)
LIM3_PINCH 146..206 CDD:188719 27/59 (46%)
LIM4_PINCH 212..265 CDD:188720 46/52 (88%)
LIM5_PINCH 273..326 CDD:188721 36/52 (69%)
LIMS3NP_001381830.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D339748at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103991
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.