DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and LPXN

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens


Alignment Length:316 Identity:89/316 - (28%)
Similarity:127/316 - (40%) Gaps:87/316 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HCTRCADGFEP-TEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCN 83
            ||..|.   :| ..|::::.|:.||.:.|||..|........|:|..|..||..|:|.||:|.|.
Human   156 HCASCQ---KPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCA 217

  Fly    84 KCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQK 148
            .|...::.:|:.||:.:|||:.|.|..|                                     
Human   218 YCAAPILDKVLTAMNQTWHPEHFFCSHC------------------------------------- 245

  Fly   149 CHGLIDEEPLRFRGEVY--HGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGI 211
                         |||:  .|:|               |...:|          ||.:....|..
Human   246 -------------GEVFGAEGFH---------------EKDKKP----------YCRKDFLAMFS 272

  Fly   212 PICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVC 276
            |.||.|.||:.|..::|:...||.|.|||..|...|.....:|..|..:||.|||...|.||..|
Human   273 PKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGC 337

  Fly   277 NQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSK--FYEYDEKPVCKKCYDR-FP 329
            .|.|.|...:|:...:...||.|:.|   :||.||  |.|.::|..|:.|::: ||
Human   338 GQPITGRCISAMGYKFHPEHFVCAFC---LTQLSKGIFREQNDKTYCQPCFNKLFP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 19/58 (33%)
LIM2_PINCH 82..133 CDD:188718 11/50 (22%)
LIM3_PINCH 146..206 CDD:188719 9/61 (15%)
LIM4_PINCH 212..265 CDD:188720 20/52 (38%)
LIM5_PINCH 273..326 CDD:188721 19/54 (35%)
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790 18/55 (33%)
LIM2_Leupaxin 216..267 CDD:188792 20/125 (16%)
LIM3_Leupaxin 275..327 CDD:188794 20/51 (39%)
LIM4_Paxillin_like 334..385 CDD:188725 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.