DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and SCEL

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_659001.2 Gene:SCEL / 8796 HGNCID:10573 Length:688 Species:Homo sapiens


Alignment Length:93 Identity:21/93 - (22%)
Similarity:39/93 - (41%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIG----RVIKAMSASWHPQCFRCQLCAKEL- 115
            :|:.|..::....|...|..|:....|..|.: .:|    .::..:....|..||:|::|.:.| 
Human   595 YQENISGKYIQTVYSTSDRSVIERDMCTYCRK-PLGVETKMILDELQICCHSTCFKCEICKQPLE 658

  Fly   116 ----ADCGFIKNQNRALCHECNAKVKAE 139
                .|..:|..|. ..|..|.:|:.|:
Human   659 NLQAGDSIWIYRQT-IHCEPCYSKIMAK 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 5/22 (23%)
LIM2_PINCH 82..133 CDD:188718 13/59 (22%)
LIM3_PINCH 146..206 CDD:188719
LIM4_PINCH 212..265 CDD:188720
LIM5_PINCH 273..326 CDD:188721
SCELNP_659001.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..231
16 X approximate tandem repeats 251..563
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..373
LIM 620..678 CDD:214528 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.