DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and PXL1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_013016.4 Gene:PXL1 / 853965 SGDID:S000001798 Length:706 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:36/129 - (27%)
Similarity:52/129 - (40%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGE-----LWHTQCFVCAQCFRPFQDGI-FYEFEGRKYCERDFHVLFA 79
            |..|  |.|.|.|.:.|..|     .||.:||.|.:|...|...: .|......||::.:|....
Yeast   556 CRAC--GLEVTGKRMFSKKENELSGQWHRECFKCIECGIKFNKHVPCYILGDEPYCQKHYHEENH 618

  Fly    80 PCCNKCGEFVIGRVIKAMSAS-WHPQCFRCQLCAKELADCGFIKNQNRALC--HECNAKVKAEI 140
            ..|..|..|:.|..::..... :|..|..|.||...:.:..:|.|....||  |:..|.:|..|
Yeast   619 SICKVCSNFIEGECLENDKVERFHVDCLNCFLCKTAITNDYYIFNGEIPLCGNHDMEALLKEGI 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 19/63 (30%)
LIM2_PINCH 82..133 CDD:188718 14/53 (26%)
LIM3_PINCH 146..206 CDD:188719
LIM4_PINCH 212..265 CDD:188720
LIM5_PINCH 273..326 CDD:188721
PXL1NP_013016.4 LIM1_UF1 556..614 CDD:188783 18/59 (31%)
LIM 621..672 CDD:259829 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1742
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.