DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and RGA2

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_010667.1 Gene:RGA2 / 851985 SGDID:S000002787 Length:1009 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:39/169 - (23%)
Similarity:58/169 - (34%) Gaps:55/169 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQ 109
            |..:|.:|.:.......||.|.:|                                ||.|||.|.
Yeast     9 QSSLCVRCNKSIASSQVYELESKK--------------------------------WHDQCFTCY 41

  Fly   110 LCAKEL-ADCGF-IKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEP--LRFRGEVYHGYHF 170
            .|.|:| ||..| :.:....:|::|:.|          |..|...||:..  |....|.|....|
Yeast    42 KCDKKLNADSDFLVLDIGTLICYDCSDK----------CTNCGDKIDDTAIILPSSNEAYCSNCF 96

  Fly   171 SCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
            .|..|...: ...:..|::.||.        |:.||:|:
Yeast    97 RCCRCSNRI-KNLKYAKTKRGLC--------CMDCHEKL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 7/33 (21%)
LIM2_PINCH 82..133 CDD:188718 13/52 (25%)
LIM3_PINCH 146..206 CDD:188719 14/61 (23%)
LIM4_PINCH 212..265 CDD:188720
LIM5_PINCH 273..326 CDD:188721
RGA2NP_010667.1 LIM1_Rga 13..67 CDD:188780 19/85 (22%)
LIM2_Rga 70..123 CDD:188781 14/61 (23%)
RhoGAP 815..1002 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.