DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and LRG1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:41/148 - (27%)
Similarity:62/148 - (41%) Gaps:33/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 ICGACRR---PIEERVVT---ALGKHWHVEHFVCAKCEKPFLGHRHY------EKRGLAYCETHY 265
            ||..|.:   |..:|..|   ||||::|...|.|..|:|| |..:::      ....:..|:..|
Yeast    27 ICARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKP-LKPKYFPYQVDKTSESILLCQYDY 90

  Fly   266 HQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDT------------KMTQKSKFYEYDEK 318
            .:....||.||:..:.|..:||....:...||:|::|.|            ::..|..|.:|..|
Yeast    91 FRRHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSCTICATPCGVKKCFMYGNQLYCKYHFLKYFSK 155

  Fly   319 PVCKKC-------YDRFP 329
            . ||.|       |..||
Yeast   156 R-CKGCEFPISDQYIEFP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718
LIM3_PINCH 146..206 CDD:188719
LIM4_PINCH 212..265 CDD:188720 18/63 (29%)
LIM5_PINCH 273..326 CDD:188721 18/71 (25%)
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777 17/62 (27%)
LIM 98..149 CDD:259829 12/50 (24%)
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.