DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and AJUBA

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_116265.1 Gene:AJUBA / 84962 HGNCID:20250 Length:538 Species:Homo sapiens


Alignment Length:255 Identity:63/255 - (24%)
Similarity:88/255 - (34%) Gaps:100/255 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFA------ 79
            |.:|..|.........:...|:|||||||..|.|..:...||...|..|||.|:  ||:      
Human   338 CIKCNKGIYGQSNACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDY--LFSGFQEAA 400

  Fly    80 -PCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGR 143
             .|| .||..::.::::||..|:||.||||                                   
Human   401 EKCC-VCGHLILEKILQAMGKSYHPGCFRC----------------------------------- 429

  Fly   144 YVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDK 208
            .||.||   :|..|..        ..||                          |::||:..:.|
Human   430 IVCNKC---LDGIPFT--------VDFS--------------------------NQVYCVTDYHK 457

  Fly   209 MGIPICGACRRPI------EERV-VTALGKHWHVEHFVCAKCEK-----------PFLGH 250
            ...|.|.||.:||      |:.| |.::.:.:|.|.:.|..|..           |..||
Human   458 NYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGH 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 21/57 (37%)
LIM2_PINCH 82..133 CDD:188718 12/50 (24%)
LIM3_PINCH 146..206 CDD:188719 10/59 (17%)
LIM4_PINCH 212..265 CDD:188720 16/57 (28%)
LIM5_PINCH 273..326 CDD:188721
AJUBANP_116265.1 PreLIM 1..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..172
PHA03418 <18..>103 CDD:177646
Nuclear localization signal. /evidence=ECO:0000255 280..288
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..315
LIM1_Ajuba_like 338..391 CDD:188738 19/52 (37%)
LIM2_Ajuba_like 403..455 CDD:188741 24/124 (19%)
LIM3_Ajuba_like 463..524 CDD:188822 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.