DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and PLIM2b

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_171683.1 Gene:PLIM2b / 839267 AraportID:AT1G01780 Length:205 Species:Arabidopsis thaliana


Alignment Length:206 Identity:51/206 - (24%)
Similarity:75/206 - (36%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKCGEFVIGRVIKAMSAS---WHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGR 143
            ||.|.:.|.  |:..:|..   :|..||||..|.      |.::..|           .:.:.|.
plant    10 CNVCDKTVY--VVDMLSIEGMPYHKSCFRCTHCK------GTLQMSN-----------YSSMDGV 55

  Fly   144 YVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDK 208
            ..| |.|   .|:..:..|.....:....|. ..||..|..::.|           ::| ...||
plant    56 LYC-KTH---FEQLFKESGNFSKNFQPGKTE-KPELTRTPSKISS-----------IFC-GTQDK 103

  Fly   209 MGIPICGACRR---PIEERVVTALGKHWHVEHFVCAK--CEKPFLGHRHYEK-RGLAYCETHYHQ 267
                 |.||.:   |:|:  :...|:.:|...|.||.  |.   |.|..|.. ..:.||..|::|
plant   104 -----CAACEKTVYPLEK--IQMEGECFHKTCFRCAHGGCT---LTHSSYASLDSVLYCRHHFNQ 158

  Fly   268 LF---GNLCFV 275
            ||   ||...|
plant   159 LFMEKGNYAHV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 14/53 (26%)
LIM3_PINCH 146..206 CDD:188719 11/59 (19%)
LIM4_PINCH 212..265 CDD:188720 16/58 (28%)
LIM5_PINCH 273..326 CDD:188721 1/3 (33%)
PLIM2bNP_171683.1 LIM1_SF3 6..68 CDD:188824 19/80 (24%)
LIM 104..164 CDD:413332 20/64 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.