Sequence 1: | NP_731242.1 | Gene: | stck / 40999 | FlyBaseID: | FBgn0020249 | Length: | 348 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_191682.2 | Gene: | PLIM2c / 825295 | AraportID: | AT3G61230 | Length: | 213 | Species: | Arabidopsis thaliana |
Alignment Length: | 200 | Identity: | 52/200 - (26%) |
---|---|---|---|
Similarity: | 77/200 - (38%) | Gaps: | 52/200 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 CNKCGEFVIGRVIKAMSAS---WHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGR 143
Fly 144 YVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDK 208
Fly 209 MGIPICGACRR---PIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEK-RGLAYCETHYHQLF 269
Fly 270 ---GN 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
stck | NP_731242.1 | LIM1_PINCH | 21..79 | CDD:188717 | |
LIM2_PINCH | 82..133 | CDD:188718 | 13/53 (25%) | ||
LIM3_PINCH | 146..206 | CDD:188719 | 12/59 (20%) | ||
LIM4_PINCH | 212..265 | CDD:188720 | 18/56 (32%) | ||
LIM5_PINCH | 273..326 | CDD:188721 | |||
PLIM2c | NP_191682.2 | LIM1_SF3 | 7..69 | CDD:188824 | 18/80 (23%) |
LIM | 107..167 | CDD:413332 | 22/62 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 56 | 1.000 | Inparanoid score | I2587 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |