DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and WLIM2a

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:252 Identity:55/252 - (21%)
Similarity:78/252 - (30%) Gaps:99/252 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKC 85
            |..|.....|.| :::::|..:|..||.|:.|....|...:...||..||...|..||    .:.
plant    10 CRACEKTVYPVE-LLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLF----KES 69

  Fly    86 GEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCH 150
            |.|         |.::       |..||.|.|                 |...|           
plant    70 GSF---------SKNF-------QSPAKPLTD-----------------KPTPE----------- 90

  Fly   151 GLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICG 215
              ::..|.|..|      .||    ||:                            ||     |.
plant    91 --LNRTPSRLAG------MFS----GTQ----------------------------DK-----CA 110

  Fly   216 ACRR---PIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLF 269
            .|.:   |||:  ||...:.:|...|.|:....|.....:....|:.||:.|:.|||
plant   111 TCTKTVYPIEK--VTVESQCYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 17/57 (30%)
LIM2_PINCH 82..133 CDD:188718 8/50 (16%)
LIM3_PINCH 146..206 CDD:188719 7/59 (12%)
LIM4_PINCH 212..265 CDD:188720 14/55 (25%)
LIM5_PINCH 273..326 CDD:188721
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 18/62 (29%)
LIM2_SF3 109..169 CDD:188825 18/59 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.