DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and lpp

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_012818600.1 Gene:lpp / 779875 XenbaseID:XB-GENE-951633 Length:614 Species:Xenopus tropicalis


Alignment Length:205 Identity:56/205 - (27%)
Similarity:82/205 - (40%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CNKCGEFVIGR--VIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRY 144
            |::|||.|:|.  ...||...:|.:||.|..|..:|....|...:.:|.|..|..:...:     
 Frog   418 CSRCGENVVGEGTGCTAMDQVFHVECFTCMTCNSKLRGQPFYAVEKKAFCEPCYIRTLEK----- 477

  Fly   145 VCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
             |..|...|.|..||..|:.||.:.|:|..|...||.....|.:        ..:::|:....|.
 Frog   478 -CSVCAKPIMERILRATGKAYHPHCFTCVVCFRSLDGIPFTVDA--------SGQIHCIEDFHKK 533

  Fly   210 GIPICGACRRPI------EERV-VTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQ 267
            ..|.|..|:.||      ||.| :.||.:.:||:.:.|..|....   ...|.:|....:.|.  
 Frog   534 FAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVQCYRCEDCGSLL---SEGENQGCYPLDGHI-- 593

  Fly   268 LFGNLCFVCN 277
                ||..||
 Frog   594 ----LCKACN 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 17/52 (33%)
LIM3_PINCH 146..206 CDD:188719 16/59 (27%)
LIM4_PINCH 212..265 CDD:188720 16/59 (27%)
LIM5_PINCH 273..326 CDD:188721 3/5 (60%)
lppXP_012818600.1 PHA03247 <4..358 CDD:223021
PRK10263 <171..>341 CDD:236669
LIM1_TRIP6 418..471 CDD:188736 17/52 (33%)
LIM 478..537 CDD:413332 17/66 (26%)
LIM3_TRIP6 538..603 CDD:188820 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.