Sequence 1: | NP_731242.1 | Gene: | stck / 40999 | FlyBaseID: | FBgn0020249 | Length: | 348 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012818600.1 | Gene: | lpp / 779875 | XenbaseID: | XB-GENE-951633 | Length: | 614 | Species: | Xenopus tropicalis |
Alignment Length: | 205 | Identity: | 56/205 - (27%) |
---|---|---|---|
Similarity: | 82/205 - (40%) | Gaps: | 32/205 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 CNKCGEFVIGR--VIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRY 144
Fly 145 VCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
Fly 210 GIPICGACRRPI------EERV-VTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYHQ 267
Fly 268 LFGNLCFVCN 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
stck | NP_731242.1 | LIM1_PINCH | 21..79 | CDD:188717 | |
LIM2_PINCH | 82..133 | CDD:188718 | 17/52 (33%) | ||
LIM3_PINCH | 146..206 | CDD:188719 | 16/59 (27%) | ||
LIM4_PINCH | 212..265 | CDD:188720 | 16/59 (27%) | ||
LIM5_PINCH | 273..326 | CDD:188721 | 3/5 (60%) | ||
lpp | XP_012818600.1 | PHA03247 | <4..358 | CDD:223021 | |
PRK10263 | <171..>341 | CDD:236669 | |||
LIM1_TRIP6 | 418..471 | CDD:188736 | 17/52 (33%) | ||
LIM | 478..537 | CDD:413332 | 17/66 (26%) | ||
LIM3_TRIP6 | 538..603 | CDD:188820 | 20/71 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |