DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fblim1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001070771.1 Gene:fblim1 / 768160 ZFINID:ZDB-GENE-061013-662 Length:292 Species:Danio rerio


Alignment Length:279 Identity:63/279 - (22%)
Similarity:91/279 - (32%) Gaps:107/279 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TRCAD--GF-----EPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFA 79
            |.|:|  ||     .|.|..:.:....:|:.||.|.||..|.....:|...|...||........
Zfish    99 THCSDVCGFCRKQVSPCESAIVALNRCYHSGCFQCRQCCAPLAGRQYYSRSGLPLCEACHQASLE 163

  Fly    80 PCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRY 144
            ||. .||:.:...||:|:..::||.||                                      
Zfish   164 PCW-ACGDVIKDHVIRALERAYHPPCF-------------------------------------- 189

  Fly   145 VCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKM 209
            ||..|...|.|:  ||                                |..::.|:|||:.:.:.
Zfish   190 VCTTCRQPIGEQ--RF--------------------------------AQGEVGEVYCLQDYYRK 220

  Fly   210 GIPICGACRRPIEER-------VVTALGKHWHVEHFVCAKC-----EKPFLGHRHYEKRGLAYCE 262
            ..|.||.|...|..|       .|..||:.:|.:.:.|..|     .:|       ::||   | 
Zfish   221 YAPQCGVCGLMIIPRDDGTDSFTVECLGRSYHEDCYRCQVCAVLLSPEP-------DERG---C- 274

  Fly   263 THYHQLFGN-LCFVCNQVI 280
               |.|.|. ||..|:..:
Zfish   275 ---HPLDGQMLCRTCHSAL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/63 (29%)
LIM2_PINCH 82..133 CDD:188718 9/50 (18%)
LIM3_PINCH 146..206 CDD:188719 11/59 (19%)
LIM4_PINCH 212..265 CDD:188720 16/64 (25%)
LIM5_PINCH 273..326 CDD:188721 2/8 (25%)
fblim1NP_001070771.1 LIM <100..158 CDD:295319 17/57 (30%)
LIM 165..217 CDD:295319 22/124 (18%)
LIM 225..287 CDD:295319 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.