DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and Fhl5

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001342427.1 Gene:Fhl5 / 57756 MGIID:1913192 Length:284 Species:Mus musculus


Alignment Length:322 Identity:71/322 - (22%)
Similarity:116/322 - (36%) Gaps:72/322 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HCTRCADGFEPTEKIVNSNGELWHTQCF------VCAQCFRPFQDGIFYEFEGRKYCERDFHVLF 78
            :||....|    :|.|..:..|:...|:      .|.||..|.      |.:.:..|.::.|   
Mouse    10 YCTSSLIG----KKYVLKDDNLYCISCYDRIFSNYCEQCKEPI------ESDSKDLCYKNRH--- 61

  Fly    79 APCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALC-----HECNAKVKA 138
                                  ||..||||..|...|.:..|:...:|.||     :||::|   
Mouse    62 ----------------------WHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSK--- 101

  Fly   139 EITGRYVCQKCHGLI--DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELY 201
                   |..|...|  ....:.|:|..:|...|.|..|       .:.:.::|.::....|  |
Mouse   102 -------CFHCKRTIMPGSRKMEFKGNYWHETCFVCEHC-------RQPIGTKPLISKESGN--Y 150

  Fly   202 CLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHYEKRGLAYCETHYH 266
            |:.|.:|.....|..|::.|....:|...:.||.|.|:|:.|.|.........|....:|...|:
Mouse   151 CVPCFEKEFAHYCNFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYN 215

  Fly   267 QLFGNLCFVCNQVI----GGDVFTALNKAWCVHHFACSVCDTKMTQKSKFYEYDEKPVCKKC 324
            .|:...|..|.:.|    |.......::.|....|.|..|...:..:. |..::.:.:|:||
Mouse   216 HLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEG-FLTHNMEILCRKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 14/63 (22%)
LIM2_PINCH 82..133 CDD:188718 13/55 (24%)
LIM3_PINCH 146..206 CDD:188719 13/61 (21%)
LIM4_PINCH 212..265 CDD:188720 13/52 (25%)
LIM5_PINCH 273..326 CDD:188721 12/56 (21%)
Fhl5NP_001342427.1 LIM <3..34 CDD:413332 7/27 (26%)
LIM1_FHL 37..95 CDD:188729 19/88 (22%)
LIM2_FHL5 102..155 CDD:188812 13/61 (21%)
LIM 163..214 CDD:413332 13/50 (26%)
LIM4_FHL 222..277 CDD:188733 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.