DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and ajuba

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_701366.4 Gene:ajuba / 572549 ZFINID:ZDB-GENE-030131-9341 Length:688 Species:Danio rerio


Alignment Length:203 Identity:53/203 - (26%)
Similarity:87/203 - (42%) Gaps:33/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERDFHVLF------A 79
            |.:|..|....:....:...|:||:||.|..|.|..::..||...|..||:.|:  :|      |
Zfish   486 CVKCGKGVYGADNACQALDSLYHTRCFTCVSCGRTLRNKDFYNVNGSVYCKEDY--MFSGFQEAA 548

  Fly    80 PCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGF----------IKNQNRALCHECNA 134
            ..|:.||..::.::::|:..|:||.||||.:|:|.|....|          :.:.||....:|.|
Zfish   549 EKCSVCGHLILEQILQALGNSYHPGCFRCTVCSKALDGVPFTVDYLNNVYCVSDYNRTFAPKCAA 613

  Fly   135 KVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMN- 198
            .::..:....         .||.||. ..:...|||.|..|    :...:::...||.....:: 
Zfish   614 CLQPILPAEG---------SEEILRV-VSMNKDYHFECYHC----EECGKQLSDEPGSQCFPLDA 664

  Fly   199 ELYCLRCH 206
            .|.|..||
Zfish   665 HLLCHSCH 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 18/63 (29%)
LIM2_PINCH 82..133 CDD:188718 17/60 (28%)
LIM3_PINCH 146..206 CDD:188719 13/60 (22%)
LIM4_PINCH 212..265 CDD:188720
LIM5_PINCH 273..326 CDD:188721
ajubaXP_701366.4 LIM1_Ajuba_like 486..539 CDD:188738 16/52 (31%)
LIM2_Ajuba_like 551..603 CDD:188741 15/51 (29%)
LIM3_Ajuba_like 611..672 CDD:188822 15/74 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.