DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and prickle3

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_698649.4 Gene:prickle3 / 570116 ZFINID:ZDB-GENE-081105-86 Length:783 Species:Danio rerio


Alignment Length:273 Identity:76/273 - (27%)
Similarity:103/273 - (37%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTEKI--VNSNGELWHTQCFVCAQCFR--PFQDG-----------------IFYEFEGRKYCERD 73
            |.:|:  |||.||.:..:     |...  |..|.                 :|.:...|:...|.
Zfish   112 PEDKVPYVNSPGERYRIK-----QLLHQLPAHDSEPQYCNSLDEEEKKELRLFSQQRKRENLGRG 171

  Fly    74 FHVLF-----APCCNKCGEFVIGRVIKAMSAS-------WHPQCFRCQLCAKELADCGFIKNQNR 126
            ...||     ...|.:||..:.|..| |:.||       ||||||:|..|.:.|.|..:......
Zfish   172 IVRLFP
VTMTGAICQQCGRQICGGDI-AVFASRAGHGSCWHPQCFQCASCNELLVDLIYFYQDGH 235

  Fly   127 ALCHECNAKVKAEITGRYVCQKCHGLI-DEEPLRFRGEVYHGYHFSCTACGTELDS---TAREVK 187
            ..|...:|:   .|..|  ||.|..:| .:|.....|..:|..||.|..|...|..   ..||  
Zfish   236 IYCGRHHA
E---HIKPR--CQACDEIIFADECTEAEGRHWHMKHFCCFECEAALGGQRYIMRE-- 293

  Fly   188 SRPGLAANDMNELYCLRCHDKMGIPICGACRR--PIEERVVTALGKHWHVEH--FVCAKCEKPFL 248
            |||          ||.||::.:....|..|..  .|::..:|..|:|||...  |.||.|..|.|
Zfish   294 SRP----------YCCRCYE
SLYAEYCDTCGEHIGIDQGQMTYEGQHWHASEQCFCCACCRLPLL 348

  Fly   249 GHRHYEKRGLAYC 261
            |.....:.||.:|
Zfish   349 GRPFLPRGGLIFC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 15/74 (20%)
LIM2_PINCH 82..133 CDD:188718 19/57 (33%)
LIM3_PINCH 146..206 CDD:188719 20/63 (32%)
LIM4_PINCH 212..265 CDD:188720 18/54 (33%)
LIM5_PINCH 273..326 CDD:188721
prickle3XP_698649.4 PET_Prickle 81..177 CDD:193602 14/69 (20%)
LIM1_Prickle 185..243 CDD:188799 19/58 (33%)
LIM2_Prickle 248..303 CDD:188802 22/68 (32%)
LIM3_Prickle 308..366 CDD:188804 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.