DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl3a

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_021322623.1 Gene:fhl3a / 567097 ZFINID:ZDB-GENE-030131-4741 Length:279 Species:Danio rerio


Alignment Length:287 Identity:75/287 - (26%)
Similarity:116/287 - (40%) Gaps:25/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIG---RVIKAMSASWHPQCFRC 108
            |.|..|........:.:.|...||...:..|||..|::|.| :||   |.:......:|..||||
Zfish     5 FDCDNCKESLYGRKYIQAEENPYCIPCYDSLFANTCDECKE-LIGHDSRELFYEDRHYHEHCFRC 68

  Fly   109 QLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--DEEPLRFRGEVYHGYHFS 171
            ..|.:.|||..|....:..||::|...   |.:.:  |..|...:  ....|.:.|..:|...|.
Zfish    69 FRCDRSLADEPFTSQDDALLCNDCYCN---EFSSK--CVACDKTVMPGTRKLEYAGSTWHEGCFI 128

  Fly   172 CTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVE 236
            |.:|...:.|.:         ...|.::.||:.|::....|.|..|::.:.:..||...:.||.|
Zfish   129 CNSCQQPIGSKS---------FIPDKDDHYCVPCYENKFAPRCTRCKQALAKGGVTYRDEPWHKE 184

  Fly   237 HFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI----GGDVFTALNKAWCVHHF 297
            .|||..|:....|.....:....||...:..|:...|..||:.|    ||...:..::.|....|
Zfish   185 CFVCTSCKVQLAGQHFTSRDDSPYCIKCFGNLYAKKCEACNKPITGFGGGKYISFEDRQWHQPCF 249

  Fly   298 ACSVCDTKMTQKSKFYEYDEKPVCKKC 324
            .||.|...:.....|.|.|| .:|:.|
Zfish   250 TCSRCSVSLVGAGFFPEQDE-ILCRNC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 7/31 (23%)
LIM2_PINCH 82..133 CDD:188718 18/53 (34%)
LIM3_PINCH 146..206 CDD:188719 12/61 (20%)
LIM4_PINCH 212..265 CDD:188720 15/52 (29%)
LIM5_PINCH 273..326 CDD:188721 17/56 (30%)
fhl3aXP_021322623.1 LIM <5..33 CDD:295319 6/27 (22%)
LIM1_FHL3 36..94 CDD:188807 21/58 (36%)
LIM2_FHL3 98..155 CDD:188811 13/67 (19%)
LIM3_FHL 162..213 CDD:188732 14/50 (28%)
LIM4_FHL3 221..276 CDD:188818 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.