DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl3b

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:286 Identity:68/286 - (23%)
Similarity:113/286 - (39%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFV--IGRVIKAMSASWHPQCFRCQ 109
            |.|..|........:.:.:.:.:|...:..|.|..|::|.|.:  ..|.:......:|.|||||.
Zfish     5 FDCESCKESLYGQKYIQVDDKPHCVPCYDRLHANTCHECKELIEHNSRELYHEDRHYHEQCFRCS 69

  Fly   110 LCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--DEEPLRFRGEVYHGYHFSC 172
            .|::.||...|...::..:|:.|...   |.:..  |..|...:  ..:.|.:...|:|...|.|
Zfish    70 RCSRSLAKESFTCQEDALVCNNCYCN---EFSSN--CVACGKTVMPGSKRLEYEDCVWHEECFVC 129

  Fly   173 TACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEH 237
              ||.|....|:..       ..|.:|.||:.|::....|.|..|::.:.:..||...:.||.|.
Zfish   130 --CGCEQPIGAQSF-------IPDKDEYYCVPCYEGRFAPRCAHCKQTLVQGGVTYRDEPWHKEC 185

  Fly   238 FVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI----GGDVFTALNKAWCVHHFA 298
            |:|..|:....|.....:....||...:..|:...|..|.:.|    .|...:...:.|....|.
Zfish   186 FLCTGCKVQLAGQPFTTQGEDPYCVKCFSNLYAQKCAACEKPITGFGEGKYVSFEERQWHKPCFK 250

  Fly   299 CSVCDTKMTQKSKFYEYDEKPVCKKC 324
            ||||...:. .:.|:.:....:||.|
Zfish   251 CSVCSLSLV-GAGFFPHGSMILCKGC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 5/31 (16%)
LIM2_PINCH 82..133 CDD:188718 15/52 (29%)
LIM3_PINCH 146..206 CDD:188719 15/61 (25%)
LIM4_PINCH 212..265 CDD:188720 14/52 (27%)
LIM5_PINCH 273..326 CDD:188721 14/56 (25%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319 4/27 (15%)
LIM1_FHL3 36..94 CDD:188807 17/57 (30%)
LIM2_FHL3 98..155 CDD:188811 16/67 (24%)
LIM3_FHL 162..213 CDD:188732 13/50 (26%)
LIM4_FHL3 221..276 CDD:188818 14/56 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.