DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and prickle1

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:XP_012814522.1 Gene:prickle1 / 549693 XenbaseID:XB-GENE-486941 Length:871 Species:Xenopus tropicalis


Alignment Length:285 Identity:70/285 - (24%)
Similarity:96/285 - (33%) Gaps:106/285 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYS---KAEVVQAAN---MSLGAMH--CTRCADGFEPTEKIVNSNGEL------------WHTQC 46
            |:|   |.|.:...|   :|...||  |.:|.      |||  :.||:            ||..|
 Frog   137 MFSAQRKKEALGRGNIKMLSRAVMHAMCEKCG------EKI--NGGEIAIFVSRAGPGVCWHPSC 193

  Fly    47 FVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLC 111
            |||:.|.....|.|::..:|:.:|.|....|..|.|:.|.|.:                      
 Frog   194 FVCSTCNELLVDLIYFYQDGKIHCGRHHAELLKPRCSACDEII---------------------- 236

  Fly   112 AKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACG 176
               .||             ||     .|..||:                    :|..||||..|.
 Frog   237 ---FAD-------------EC-----TEAEGRH--------------------WHMNHFSCYECE 260

  Fly   177 TELDSTAREVK-SRPGLAANDMNELYCLRCHDKMGIPICGACRRPI--EERVVTALGKHWHVEH- 237
            |.|......:| .||          :|..|.:......|.:|...|  :...:|..|:|||... 
 Frog   261 TVLGGQRYIMKDGRP----------FCCGCFESHYAEYCESCGEHIGVDHAQMTYDGQHWHATET 315

  Fly   238 -FVCAKCEKPFLGHRHYEKRGLAYC 261
             |.||:|:...||.....|:|..||
 Frog   316 CFSCAQCKVSLLGCPFLPKKGRIYC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 20/69 (29%)
LIM2_PINCH 82..133 CDD:188718 6/50 (12%)
LIM3_PINCH 146..206 CDD:188719 12/60 (20%)
LIM4_PINCH 212..265 CDD:188720 18/54 (33%)
LIM5_PINCH 273..326 CDD:188721
prickle1XP_012814522.1 PET_Prickle 60..156 CDD:193602 5/18 (28%)
LIM1_Prickle 164..222 CDD:188799 19/65 (29%)
LIM2_Prickle 227..282 CDD:188802 24/127 (19%)
LIM3_Prickle 287..345 CDD:188804 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.