DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stck and fhl3

DIOPT Version :9

Sequence 1:NP_731242.1 Gene:stck / 40999 FlyBaseID:FBgn0020249 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_001008165.1 Gene:fhl3 / 493527 XenbaseID:XB-GENE-947662 Length:279 Species:Xenopus tropicalis


Alignment Length:289 Identity:77/289 - (26%)
Similarity:120/289 - (41%) Gaps:29/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FVCAQCFRPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIG---RVIKAMSASWHPQCFRC 108
            |.|..|........:.:.|...||...:..|||..|::|.| :||   |.:......:|..||||
 Frog     5 FDCDSCKESLYGRKYIQMEEGPYCIPCYDSLFANTCDECKE-LIGHDCRELYYEDRHYHEHCFRC 68

  Fly   109 QLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI--DEEPLRFRGEVYHGYHFS 171
            ..|...|||..|.......||::|...   |.:.:  |..|...:  ....|.:.|:.:|.:.|.
 Frog    69 FRCDHSLADEPFTCQDEELLCNDCYCN---EFSSK--CISCEKTVMPGSRKLEYNGQTWHEHCFI 128

  Fly   172 CTACGTELDSTAREVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVE 236
            |.:|       .:.:.||..:..|..:  ||:.|::....|.|..|::.:.:..||...:.||.|
 Frog   129 CNSC-------QQPIGSRSFIPENQNH--YCIPCYESKLAPRCTHCKKSLTKGGVTYRDEPWHKE 184

  Fly   237 HFVCAKCEKPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVI---GGDVFTAL-NKAWCVHH- 296
            .|||..|:....|.:...:....||...:..|:...|..|.:.|   ||..:.:. .:.|  || 
 Frog   185 CFVCTGCKTQLAGQQFTSQDEKPYCIKCFGNLYAKKCAGCTKPITGFGGAKYVSFEERHW--HHS 247

  Fly   297 -FACSVCDTKMTQKSKFYEYDEKPVCKKC 324
             |.||.|.|.:..|. |...:|..:|:.|
 Frog   248 CFNCSRCSTSLVGKG-FIPDNEDILCRAC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stckNP_731242.1 LIM1_PINCH 21..79 CDD:188717 7/31 (23%)
LIM2_PINCH 82..133 CDD:188718 18/53 (34%)
LIM3_PINCH 146..206 CDD:188719 13/61 (21%)
LIM4_PINCH 212..265 CDD:188720 15/52 (29%)
LIM5_PINCH 273..326 CDD:188721 18/58 (31%)
fhl3NP_001008165.1 LIM <5..33 CDD:351770 6/27 (22%)
LIM1_FHL3 36..94 CDD:188807 21/58 (36%)
LIM2_FHL3 98..155 CDD:188811 14/67 (21%)
LIM3_FHL 162..213 CDD:188732 14/50 (28%)
LIM4_FHL3 221..276 CDD:188818 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51900
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.